StarFunc result for job id P47755

User Input

>input (286 residues)
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESW
RTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P28497	0.999	0.999	2.012E-52	286	0.951	0.951	P28497.pdb.gz	CAZA2_CHICK F-actin-capping protein subunit alpha-2 OS=Gallus gallus OX=9031 GN=CAPZA2 PE=1 SV=1
2	AFDB:P13127	0.914	0.914	8.366E-48	286	0.860	0.860	P13127.pdb.gz	CAZA1_CHICK F-actin-capping protein subunit alpha-1 OS=Gallus gallus OX=9031 GN=CAPZA1 PE=1 SV=1
3	AFDB:Q6NWK1	0.995	0.995	1.649E-47	286	0.808	0.808	Q6NWK1.pdb.gz
4	PDB:1iznA	0.918	0.954	1.650E-41	275	0.822	0.855	1iznA.pdb.gz
5	AFDB:Q9W2N0	0.965	0.965	3.719E-39	286	0.601	0.601	Q9W2N0.pdb.gz	CAPZA_DROME F-actin-capping protein subunit alpha OS=Drosophila melanogaster OX=7227 GN=cpa PE=2 SV=1
6	AFDB:P34685	0.907	0.920	3.226E-34	282	0.524	0.532	P34685.pdb.gz	CAPZA_CAEEL F-actin-capping protein subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cap-1 PE=2 SV=1
7	AFDB:P13022	0.917	0.933	3.450E-30	281	0.385	0.391	P13022.pdb.gz	CAPZA_DICDI F-actin-capping protein subunit alpha OS=Dictyostelium discoideum OX=44689 GN=acpB PE=1 SV=1
8	PDB:4akrC	0.896	0.944	2.573E-28	271	0.378	0.399	4akrC.pdb.gz
9	AFDB:P70190	0.904	0.866	1.840E-27	299	0.353	0.338	P70190.pdb.gz	CAZA3_MOUSE F-actin-capping protein subunit alpha-3 OS=Mus musculus OX=10090 GN=Capza3 PE=2 SV=1
10	AFDB:F4J7C4	0.927	0.699	3.904E-26	382	0.311	0.233	F4J7C4.pdb.gz	F4J7C4_ARATH Subunits of heterodimeric actin filament capping protein Capz superfamily OS=Arabidopsis thaliana OX=3702 GN=CPA PE=1 SV=1
11	AFDB:P28495	0.820	0.872	5.634E-21	268	0.283	0.302	P28495.pdb.gz	CAPZA_YEAST F-actin-capping protein subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAP1 PE=1 SV=1
12	AFDB:Q10434	0.784	0.871	2.070E-20	256	0.245	0.273	Q10434.pdb.gz	CAPZA_SCHPO F-actin-capping protein subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=acp1 PE=1 SV=1
13	PDB:7pdzE	0.562	0.586	9.636E-10	272	0.140	0.147	7pdzE.pdb.gz	A barbed end interference mechanism reveals how capping protein promotes nucleation in branched actin networks.
14	PDB:4akrB	0.544	0.624	1.541E-8	245	0.126	0.147	4akrB.pdb.gz
15	PDB:4oqdC	0.098	0.113	7.417E-2	241	0.073	0.087	4oqdC.pdb.gz	Production of a novel N-monomethylated dideoxysugar.
16	PDB:1agiA	0.075	0.124	1.102E-1	125	0.024	0.056	1agiA.pdb.gz
17	PDB:4q35B	0.121	0.211	1.306E-1	150	0.077	0.147	4q35B.pdb.gz	Structural basis for lipopolysaccharide insertion in the bacterial outer membrane.
18	PDB:7ohaM	0.093	0.213	1.306E-1	107	0.035	0.093	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
19	PDB:7o4iB	0.104	0.038	1.382E-1	1180	0.031	0.008	7o4iB.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
20	PDB:1ek9A	0.101	0.072	1.638E-1	428	0.108	0.072	1ek9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P13127	0.0	511	286	0.860	0.860	CAZA1_CHICK F-actin-capping protein subunit alpha-1 OS=Gallus gallus OX=9031 GN=CAPZA1 PE=1 SV=1
2	P28497	0.0	554	286	0.951	0.951	CAZA2_CHICK F-actin-capping protein subunit alpha-2 OS=Gallus gallus OX=9031 GN=CAPZA2 PE=1 SV=1
3	P47753	0.0	511	286	0.860	0.860	CAZA1_MOUSE F-actin-capping protein subunit alpha-1 OS=Mus musculus OX=10090 GN=Capza1 PE=1 SV=4
4	P47754	0.0	593	286	0.983	0.983	CAZA2_MOUSE F-actin-capping protein subunit alpha-2 OS=Mus musculus OX=10090 GN=Capza2 PE=1 SV=3
5	P47755	0.0	600	286	1.000	1.000	CAZA2_HUMAN F-actin-capping protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=CAPZA2 PE=1 SV=3
6	P52907	0.0	512	286	0.867	0.867	CAZA1_HUMAN F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3
7	Q7ZUR4	6.13e-171	476	286	0.804	0.804	Q7ZUR4_DANRE F-actin-capping protein subunit alpha OS=Danio rerio OX=7955 GN=capza1 PE=1 SV=1
8	Q9W2N0	6.05e-132	377	286	0.601	0.601	CAPZA_DROME F-actin-capping protein subunit alpha OS=Drosophila melanogaster OX=7227 GN=cpa PE=2 SV=1
9	P34685	1.89e-99	295	282	0.528	0.535	CAPZA_CAEEL F-actin-capping protein subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cap-1 PE=2 SV=1
10	P13022	1.67e-71	223	281	0.392	0.399	CAPZA_DICDI F-actin-capping protein subunit alpha OS=Dictyostelium discoideum OX=44689 GN=acpB PE=1 SV=1
11	P70190	1.90e-63	203	299	0.357	0.341	CAZA3_MOUSE F-actin-capping protein subunit alpha-3 OS=Mus musculus OX=10090 GN=Capza3 PE=2 SV=1
12	Q9WUV6	2.58e-63	203	299	0.360	0.344	CAZA3_RAT F-actin-capping protein subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Capza3 PE=1 SV=1
13	Q96KX2	4.87e-62	199	299	0.343	0.328	CAZA3_HUMAN F-actin-capping protein subunit alpha-3 OS=Homo sapiens OX=9606 GN=CAPZA3 PE=1 SV=2
14	F4J7C4	2.58e-43	154	382	0.308	0.230	F4J7C4_ARATH Subunits of heterodimeric actin filament capping protein Capz superfamily OS=Arabidopsis thaliana OX=3702 GN=CPA PE=1 SV=1
15	P28495	4.12e-34	126	268	0.297	0.317	CAPZA_YEAST F-actin-capping protein subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAP1 PE=1 SV=1
16	Q10434	4.97e-26	105	256	0.269	0.301	CAPZA_SCHPO F-actin-capping protein subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=acp1 PE=1 SV=1
17	Q9F2F9	0.29	35.0	382	0.070	0.052	ELMGT_STROV Elloramycin glycosyltransferase ElmGT OS=Streptomyces olivaceus OX=47716 GN=elmGT PE=1 SV=2
18	Q1L673	0.53	34.3	422	0.070	0.047	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
19	O17010	1.4	32.7	324	0.080	0.071	O17010_CAEEL Serpentine Receptor, class AB (Class A-like) OS=Caenorhabditis elegans OX=6239 GN=srab-16 PE=4 SV=2
20	Q9PTN2	3.8	31.6	453	0.084	0.053	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03150 CCP_MauG	4.7e+02	12.8	Di-haem cytochrome c peroxidase
2	PF01267 F-actin_cap_A	4e-100	346.2	F-actin capping protein alpha subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010387645.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010383851.1	0.987	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
2	61622.XP_010357359.1	0.934	F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
3	61622.XP_010387208.1	0.934	F-actin-capping protein subunit alpha-1
4	61622.XP_010371966.1	0.908	Dynactin subunit 4
5	61622.XP_010387258.1	0.907	Dynactin subunit 2 isoform X1
6	61622.XP_010355991.1	0.897	Belongs to the actin family.
7	61622.XP_010368392.1	0.891	Belongs to the S-100 family.
8	61622.XP_010369190.1	0.890	Dynactin subunit 6
9	61622.XP_010372934.1	0.871	Myotrophin
10	61622.XP_010354124.1	0.865	ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament
11	61622.XP_010358515.1	0.860	Actin-related protein 2/3 complex subunit 2
12	61622.XP_010362219.1	0.855	WASH complex subunit 5
13	61622.XP_010354474.1	0.828	ARP1 actin-related protein 1 homolog A, centractin alpha
14	61622.XP_010360412.1	0.825	ARP1 actin-related protein 1 homolog B, centractin beta
15	61622.XP_010377534.1	0.807	Dynactin subunit 1 isoform X1
16	61622.XP_010356524.1	0.805	Dynactin subunit 5
17	61622.XP_010351938.1	0.782	Cytoplasmic dynein 1 heavy chain 1
18	61622.XP_010384094.1	0.776	Dynactin subunit 3
19	61622.XP_010353468.1	0.768	Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in binding dynein to membranous organelles or chromosomes.
20	61622.XP_010379595.1	0.756	WASH complex subunit CCDC53 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.795	cytoskeletal protein binding
GO:0003779	0.599	actin binding
GO:0044877	0.506	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.995	cellular component organization
GO:0050794	0.892	regulation of cellular process
GO:0044085	0.872	cellular component biogenesis
GO:0043933	0.845	protein-containing complex organization
GO:0051128	0.708	regulation of cellular component organization
GO:0022607	0.691	cellular component assembly
GO:0044087	0.516	regulation of cellular component biogenesis
GO:0033043	0.475	regulation of organelle organization
GO:0065003	0.403	protein-containing complex assembly
GO:0048523	0.366	negative regulation of cellular process
GO:0065008	0.307	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0043227	0.993	membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0016020	0.975	membrane
GO:0005576	0.970	extracellular region
GO:0071944	0.952	cell periphery
GO:0031982	0.932	vesicle
GO:0005856	0.915	cytoskeleton
GO:0065010	0.882	extracellular membrane-bounded organelle
GO:0070062	0.861	extracellular exosome
GO:0005886	0.830	plasma membrane
GO:0043231	0.815	intracellular membrane-bounded organelle
GO:0015629	0.758	actin cytoskeleton
GO:0005634	0.487	nucleus
GO:0031981	0.368	nuclear lumen
GO:0005938	0.362	cell cortex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]