StarFunc result for job id P47897

User Input

>input (775 residues)
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLA
SRLRDTRRLSFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPE
QIEEAVEAAINRHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPK
LEADLEKKFKVAKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKT
PGYVVTPHTMNLLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFL
RFDDTNPEKEEAKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQ
RGEELKGHNTLPSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRV
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPV
QWEYGRLNLHYAVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVG
VTVAQTTMEPHLLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADET
KGFHQVPFAPIVFIERTDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVES
LEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASL
HVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4ye6A	0.897	0.980	0.000	709	0.910	0.994	4ye6A.pdb.gz
2	AFDB:P47897	1.000	1.000	0.000	775	1.000	1.000	P47897.pdb.gz	SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
3	AFDB:Q8BML9	0.986	0.986	0.000	775	0.899	0.899	Q8BML9.pdb.gz	SYQ_MOUSE Glutamine--tRNA ligase OS=Mus musculus OX=10090 GN=Qars1 PE=1 SV=1
4	AFDB:Q9Y105	0.714	0.711	0.000	778	0.579	0.577	Q9Y105.pdb.gz	SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GlnRS PE=2 SV=1
5	AFDB:F4ICG2	0.712	0.691	4.035E-86	800	0.419	0.406	F4ICG2.pdb.gz	F4ICG2_ARATH Glutamine-tRNA ligase, putative / glutaminyl-tRNA synthetase, putative / GlnRS OS=Arabidopsis thaliana OX=3702 GN=OVA9 PE=1 SV=1
6	AFDB:Q9Y7Y8	0.819	0.785	1.660E-83	811	0.432	0.413	Q9Y7Y8.pdb.gz	SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qrs1 PE=3 SV=1
7	AFDB:P13188	0.661	0.634	5.495E-81	809	0.404	0.387	P13188.pdb.gz	SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLN4 PE=1 SV=2
8	PDB:4h3sA	0.640	0.842	4.257E-65	585	0.332	0.439	4h3sA.pdb.gz	The Structure of Yeast Glutaminyl-tRNA Synthetase and Modeling of Its Interaction with tRNA.
9	AFDB:P00962	0.636	0.884	4.831E-65	554	0.312	0.437	P00962.pdb.gz	SYQ_ECOLI Glutamine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=glnS PE=1 SV=3
10	PDB:4jyzA	0.629	0.890	1.048E-61	542	0.310	0.443	4jyzA.pdb.gz	Structural and Mechanistic Basis for Enhanced Translational Efficiency by 2-Thiouridine at the tRNA Anticodon Wobble Position.
11	AFDB:P56926	0.620	0.566	1.613E-58	852	0.301	0.273	P56926.pdb.gz	SYQ_DEIRA Glutamine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=glnS PE=1 SV=1
12	PDB:2hz7A	0.612	0.845	2.806E-57	556	0.285	0.397	2hz7A.pdb.gz
13	AFDB:A0A0U1RQT0	0.427	0.950	1.478E-48	342	0.441	1.000	A0A0U1RQT0.pdb.gz	A0A0U1RQT0_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
14	AFDB:O13775	0.592	0.639	1.016E-46	716	0.235	0.254	O13775.pdb.gz	SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gus1 PE=1 SV=1
15	PDB:2ja2A	0.296	0.456	2.774E-11	485	0.085	0.136	2ja2A.pdb.gz
16	PDB:4a91A	0.257	0.625	9.418E-10	290	0.067	0.179	4a91A.pdb.gz	Crystal Structure of Glutamyl-Queuosine Trnaasp Synthetase Complexed with L-Glutamate: Structural Elements Mediating tRNA-Independent Activation of Glutamate and Glutamylation of Trnaasp Anticodon.
17	PDB:1u0bB	0.253	0.401	1.028E-6	461	0.063	0.106	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
18	PDB:1li7B	0.234	0.443	4.955E-6	375	0.058	0.120	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
19	PDB:5yymA	0.200	0.258	1.321E-3	581	0.062	0.083	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
20	PDB:2dlcX	0.178	0.367	1.930E-3	339	0.032	0.074	2dlcX.pdb.gz	Structural basis for recognition of cognate tRNA by tyrosyl-tRNA synthetase from three kingdoms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQT0	0.0	689	342	0.441	1.000	A0A0U1RQT0_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
2	B4DDN1	0.0	1326	630	0.813	1.000	B4DDN1_HUMAN glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
3	F4ICG2	0.0	588	800	0.427	0.414	F4ICG2_ARATH Glutamine-tRNA ligase, putative / glutaminyl-tRNA synthetase, putative / GlnRS OS=Arabidopsis thaliana OX=3702 GN=OVA9 PE=1 SV=1
4	P47897	0.0	1617	775	1.000	1.000	SYQ_HUMAN Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
5	Q8BML9	0.0	1458	775	0.899	0.899	SYQ_MOUSE Glutamine--tRNA ligase OS=Mus musculus OX=10090 GN=Qars1 PE=1 SV=1
6	Q96AW5	0.0	1501	717	0.924	0.999	Q96AW5_HUMAN glutamine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 GN=QARS PE=2 SV=2
7	Q9Y105	0.0	930	778	0.579	0.577	SYQ_DROME Probable glutamine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GlnRS PE=2 SV=1
8	Q9Y7Y8	0.0	581	811	0.443	0.423	SYQ_SCHPO Probable glutamine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qrs1 PE=3 SV=1
9	H7C0R3	8.87e-177	508	253	0.326	1.000	H7C0R3_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
10	P13188	7.51e-176	527	809	0.412	0.394	SYQ_YEAST Glutamine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLN4 PE=1 SV=2
11	P00962	8.65e-146	441	554	0.317	0.444	SYQ_ECOLI Glutamine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=glnS PE=1 SV=3
12	A0A0U1RQE9	4.61e-125	373	187	0.241	1.000	A0A0U1RQE9_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
13	A0A0U1RRI9	5.78e-120	360	182	0.235	1.000	A0A0U1RRI9_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=2
14	A0A0U1RQL2	3.05e-111	338	191	0.222	0.901	A0A0U1RQL2_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
15	P56926	6.54e-109	353	852	0.295	0.269	SYQ_DEIRA Glutamine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=glnS PE=1 SV=1
16	A0A0U1RQM8	5.54e-108	328	173	0.209	0.936	A0A0U1RQM8_HUMAN Glutaminyl-tRNA synthetase 1 (Fragment) OS=Homo sapiens OX=9606 GN=QARS1 PE=1 SV=1
17	Q587C5	1.32e-75	258	607	0.225	0.287	Q587C5_TRYB2 glutamate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.450 PE=3 SV=1
18	O13775	3.99e-73	254	716	0.226	0.244	SYEC_SCHPO Probable glutamate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gus1 PE=1 SV=1
19	P07814	1.05e-72	261	1512	0.234	0.120	SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5
20	Q8CGC7	8.24e-70	252	1512	0.232	0.119	SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus OX=10090 GN=Eprs1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00749 tRNA-synt_1c	3.4e-114	392.6	tRNA synthetases class I (E and Q), catalytic domain
2	PF03950 tRNA-synt_1c_C	2.8e-39	146.3	tRNA synthetases class I (E and Q), anti-codon binding domain
3	PF04558 tRNA_synt_1c_R1	1e-45	167.2	Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1
4	PF04557 tRNA_synt_1c_R2	1.8e-22	91.3	Glutaminyl-tRNA synthetase, non-specific RNA binding region part 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10116.ENSRNOP00000067775

Rank	PPI partner	STRING score	Description
1	10116.ENSRNOP00000033323	0.986	glutamyl-prolyl-tRNA synthetase
2	10116.ENSRNOP00000034945	0.979	methionyl-tRNA synthetase
3	10116.ENSRNOP00000010252	0.972	Arginine--tRNA ligase, cytoplasmic
4	10116.ENSRNOP00000064303	0.964	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
5	10116.ENSRNOP00000018891	0.963	Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
6	10116.ENSRNOP00000025284	0.962	leucyl-tRNA synthetase
7	10116.ENSRNOP00000019862	0.959	Isoleucine-tRNA synthetase (Predicted)
8	10116.ENSRNOP00000010674	0.954	Tyrosine--tRNA ligase, cytoplasmic
9	10116.ENSRNOP00000044454	0.934	Lysine--tRNA ligase
10	10116.ENSRNOP00000001160	0.926	Valine--tRNA ligase
11	10116.ENSRNOP00000015213	0.925	Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
12	10116.ENSRNOP00000005127	0.922	Aspartate--tRNA ligase, cytoplasmic
13	10116.ENSRNOP00000050433	0.920	Uncharacterized protein
14	10116.ENSRNOP00000001536	0.909	Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
15	10116.ENSRNOP00000063917	0.909	Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
16	10116.ENSRNOP00000001379	0.883	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
17	10116.ENSRNOP00000046565	0.814	Valine--tRNA ligase, mitochondrial
18	10116.ENSRNOP00000022065	0.813	Eukaryotic translation elongation factor 1 epsilon 1
19	10116.ENSRNOP00000060418	0.801	Glutamine--tRNA ligase
20	10116.ENSRNOP00000011687	0.776	arginyl-tRNA synthetase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004819	0.998	glutamine-tRNA ligase activity
GO:0019207	0.981	kinase regulator activity
GO:1901363	0.920	heterocyclic compound binding
GO:0097159	0.920	organic cyclic compound binding
GO:0019899	0.916	enzyme binding
GO:0003676	0.898	nucleic acid binding
GO:0019210	0.885	kinase inhibitor activity
GO:0004860	0.879	protein kinase inhibitor activity
GO:0003723	0.878	RNA binding
GO:0019900	0.860	kinase binding
GO:0019901	0.791	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0044237	0.987	cellular metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0051246	0.982	regulation of protein metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0043170	0.949	macromolecule metabolic process
GO:0034641	0.941	cellular nitrogen compound metabolic process
GO:1901564	0.939	organonitrogen compound metabolic process
GO:0010467	0.936	gene expression
GO:0044260	0.927	cellular macromolecule metabolic process
GO:0019538	0.926	protein metabolic process
GO:0043603	0.925	amide metabolic process
GO:1901576	0.919	organic substance biosynthetic process
GO:0006518	0.915	peptide metabolic process
GO:0006412	0.914	translation
GO:0010556	0.887	regulation of macromolecule biosynthetic process
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0006139	0.850	nucleobase-containing compound metabolic process
GO:0010468	0.776	regulation of gene expression
GO:0016070	0.762	RNA metabolic process
GO:0034660	0.745	ncRNA metabolic process
GO:0044281	0.458	small molecule metabolic process
GO:0048518	0.450	positive regulation of biological process
GO:0019752	0.405	carboxylic acid metabolic process
GO:0006520	0.400	amino acid metabolic process
GO:0006399	0.396	tRNA metabolic process
GO:0043038	0.380	amino acid activation
GO:0006418	0.349	tRNA aminoacylation for protein translation
GO:0032501	0.345	multicellular organismal process
GO:0032502	0.313	developmental process
GO:0048856	0.304	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0140535	0.994	intracellular protein-containing complex
GO:1902494	0.989	catalytic complex
GO:0005829	0.989	cytosol
GO:0070013	0.982	intracellular organelle lumen
GO:0017101	0.981	aminoacyl-tRNA synthetase multienzyme complex
GO:0043227	0.972	membrane-bounded organelle
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0005634	0.614	nucleus
GO:0031981	0.538	nuclear lumen
GO:0043232	0.451	intracellular non-membrane-bounded organelle
GO:0005739	0.426	mitochondrion
GO:0005654	0.408	nucleoplasm
GO:0016020	0.401	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20121	0.998	ATP + L-glutamine + tRNA(Gln) = AMP + diphosphate + L-glutaminyl-tRNA(Gln)
EC:6.1.1.18	0.998	glutamine--tRNA ligase.

[back to server]