StarFunc result for job id P47928

User Input

>input (161 residues)
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41139	0.566	0.566	5.591E-23	161	0.981	0.981	P41139.pdb.gz	ID4_MOUSE DNA-binding protein inhibitor ID-4 OS=Mus musculus OX=10090 GN=Id4 PE=1 SV=1
2	AFDB:Q7ZXF3	0.328	0.400	2.722E-11	131	0.609	0.748	Q7ZXF3.pdb.gz	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
3	AFDB:Q32PN8	0.357	0.454	2.312E-8	126	0.484	0.619	Q32PN8.pdb.gz	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
4	AFDB:Q9PWJ5	0.328	0.393	7.465E-7	133	0.366	0.444	Q9PWJ5.pdb.gz	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
5	AFDB:Q7SZQ2	0.303	0.353	3.122E-6	137	0.373	0.438	Q7SZQ2.pdb.gz	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
6	AFDB:Q8QFX4	0.311	0.421	3.577E-6	116	0.311	0.431	Q8QFX4.pdb.gz	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
7	AFDB:P41134	0.293	0.303	1.254E-3	155	0.360	0.374	P41134.pdb.gz	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
8	AFDB:Q9Y4Z2	0.284	0.223	6.007E-3	214	0.261	0.196	Q9Y4Z2.pdb.gz	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
9	AFDB:O08718	0.263	0.210	1.187E-2	214	0.205	0.154	O08718.pdb.gz	O08718_RAT Neurogenin 3 OS=Rattus norvegicus OX=10116 GN=Neurog3 PE=4 SV=1
10	AFDB:Q8N100	0.280	0.295	1.457E-2	152	0.255	0.270	Q8N100.pdb.gz	ATOH7_HUMAN Transcription factor ATOH7 OS=Homo sapiens OX=9606 GN=ATOH7 PE=1 SV=1
11	PDB:5wlcNE	0.137	0.140	1.171	158	0.180	0.184	5wlcNE.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:7pubCI	0.162	0.078	2.652	427	0.068	0.026	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
13	PDB:3ojaA	0.247	0.090	2.839	482	0.043	0.015	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
14	PDB:6iczM	0.128	0.151	3.483	130	0.124	0.154	6iczM.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:6yxyBJ	0.160	0.092	6.006	293	0.068	0.038	6yxyBJ.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:6zx9C	0.154	0.105	6.006	257	0.143	0.089	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
17	PDB:1ek8A	0.192	0.170	6.430	185	0.050	0.043	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
18	PDB:7o42A	0.124	0.029	6.430	937	0.037	0.006	7o42A.pdb.gz
19	PDB:7aocD	0.123	0.405	7.368	39	0.043	0.179	7aocD.pdb.gz	Conserved strategies of RNA polymerase I hibernation and activation.
20	PDB:5gxvA	0.140	0.059	8.444	455	0.050	0.018	5gxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47928	2.30e-112	317	161	1.000	1.000	ID4_HUMAN DNA-binding protein inhibitor ID-4 OS=Homo sapiens OX=9606 GN=ID4 PE=1 SV=1
2	P41139	1.29e-109	310	161	0.981	0.981	ID4_MOUSE DNA-binding protein inhibitor ID-4 OS=Mus musculus OX=10090 GN=Id4 PE=1 SV=1
3	Q7ZXF3	4.17e-58	179	131	0.671	0.824	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
4	Q32PN8	5.96e-45	145	126	0.540	0.690	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
5	Q7SZQ2	4.42e-29	105	137	0.422	0.496	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
6	Q02363	8.85e-28	102	134	0.398	0.478	ID2_HUMAN DNA-binding protein inhibitor ID-2 OS=Homo sapiens OX=9606 GN=ID2 PE=1 SV=1
7	P41136	2.15e-27	101	134	0.391	0.470	ID2_MOUSE DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=3
8	O73933	3.99e-27	100	134	0.416	0.500	O73933_CHICK Id2 OS=Gallus gallus OX=9031 GN=ID2 PE=2 SV=1
9	Q3LSV1	6.64e-27	100	134	0.410	0.493	Q3LSV1_COTJA Id2 OS=Coturnix japonica OX=93934 GN=Id2 PE=2 SV=1
10	P41137	6.72e-27	100	134	0.385	0.463	ID2_RAT DNA-binding protein inhibitor ID-2 OS=Rattus norvegicus OX=10116 GN=Id2 PE=1 SV=1
11	Q9PWJ5	1.21e-26	99.4	133	0.422	0.511	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
12	Q6IQW5	8.29e-25	94.7	128	0.354	0.445	Q6IQW5_DANRE DNA-binding protein inhibitor ID-1 OS=Danio rerio OX=7955 GN=cb108 PE=1 SV=1
13	P41134	1.86e-21	86.7	155	0.398	0.413	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
14	Q8QFX4	3.27e-21	85.1	116	0.304	0.422	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
15	Q90X14	2.03e-19	80.9	125	0.304	0.392	Q90X14_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id3 PE=2 SV=1
16	P20067	4.51e-19	80.9	168	0.304	0.292	ID1_MOUSE DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3
17	P41135	5.67e-19	80.5	164	0.304	0.299	ID1_RAT DNA-binding protein inhibitor ID-1 OS=Rattus norvegicus OX=10116 GN=Id1 PE=1 SV=1
18	P41138	1.02e-18	78.6	119	0.373	0.504	ID3_RAT DNA-binding protein inhibitor ID-3 OS=Rattus norvegicus OX=10116 GN=Id3 PE=1 SV=1
19	Q02535	1.27e-18	78.6	119	0.379	0.513	ID3_HUMAN DNA-binding protein inhibitor ID-3 OS=Homo sapiens OX=9606 GN=ID3 PE=1 SV=2
20	P41133	2.67e-18	77.8	119	0.366	0.496	ID3_MOUSE DNA-binding protein inhibitor ID-3 OS=Mus musculus OX=10090 GN=Id3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1e-10	52.7	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000003934

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000018208	0.770	Oligodendrocyte transcription factor 1
2	60711.ENSCSAP00000003338	0.642	Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
3	60711.ENSCSAP00000018209	0.620	Oligodendrocyte lineage transcription factor 2
4	60711.ENSCSAP00000014158	0.597	Transcription factor 4
5	60711.ENSCSAP00000003695	0.586	Early growth response 2
6	60711.ENSCSAP00000008152	0.576	Transcription factor 3
7	60711.ENSCSAP00000010422	0.529	Myogenin (myogenic factor 4)
8	60711.ENSCSAP00000001300	0.523	NGFI-A binding protein 2 (EGR1 binding protein 2)
9	60711.ENSCSAP00000017292	0.521	Hes family bHLH transcription factor 5
10	60711.ENSCSAP00000004974	0.509	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140678	1.000	molecular function inhibitor activity
GO:0061629	0.997	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140416	0.994	transcription regulator inhibitor activity
GO:0003677	0.910	DNA binding
GO:0043565	0.885	sequence-specific DNA binding
GO:0140110	0.854	transcription regulator activity
GO:0003700	0.723	DNA-binding transcription factor activity
GO:0003690	0.660	double-stranded DNA binding
GO:1990837	0.634	sequence-specific double-stranded DNA binding
GO:0000981	0.450	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.431	transcription cis-regulatory region binding
GO:0000977	0.341	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0009892	0.995	negative regulation of metabolic process
GO:0048523	0.992	negative regulation of cellular process
GO:0006357	0.988	regulation of transcription by RNA polymerase II
GO:0010605	0.974	negative regulation of macromolecule metabolic process
GO:0009987	0.973	cellular process
GO:0032502	0.958	developmental process
GO:0048856	0.953	anatomical structure development
GO:0032501	0.947	multicellular organismal process
GO:0051172	0.945	negative regulation of nitrogen compound metabolic process
GO:0031324	0.945	negative regulation of cellular metabolic process
GO:0000122	0.938	negative regulation of transcription by RNA polymerase II
GO:0007275	0.907	multicellular organism development
GO:0048731	0.854	system development
GO:0048518	0.838	positive regulation of biological process
GO:0048522	0.826	positive regulation of cellular process
GO:0010604	0.779	positive regulation of macromolecule metabolic process
GO:0048513	0.657	animal organ development
GO:0031325	0.627	positive regulation of cellular metabolic process
GO:0051173	0.564	positive regulation of nitrogen compound metabolic process
GO:0050896	0.547	response to stimulus
GO:0030154	0.447	cell differentiation
GO:0045935	0.431	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.408	positive regulation of cellular biosynthetic process
GO:0010557	0.389	positive regulation of macromolecule biosynthetic process
GO:0051254	0.389	positive regulation of RNA metabolic process
GO:0051716	0.382	cellular response to stimulus
GO:0050793	0.346	regulation of developmental process
GO:0045595	0.335	regulation of cell differentiation
GO:0045893	0.335	positive regulation of DNA-templated transcription
GO:0051239	0.311	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.872	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]