StarFunc result for job id P47929

User Input

>input (136 residues)
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47929	1.000	1.000	1.864E-26	136	1.000	1.000	P47929.pdb.gz	LEG7_HUMAN Galectin-7 OS=Homo sapiens OX=9606 GN=LGALS7 PE=1 SV=2
2	PDB:3zxfB	0.958	0.944	1.510E-23	138	1.000	0.986	3zxfB.pdb.gz
3	AFDB:O54974	0.975	0.975	7.816E-23	136	0.787	0.787	O54974.pdb.gz	LEG7_MOUSE Galectin-7 OS=Mus musculus OX=10090 GN=Lgals7 PE=2 SV=3
4	AFDB:Q8K419	0.960	0.407	5.755E-16	326	0.375	0.156	Q8K419.pdb.gz	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
5	AFDB:P56470	0.961	0.411	2.412E-15	323	0.382	0.161	P56470.pdb.gz	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
6	AFDB:O54891	0.958	0.438	3.822E-15	301	0.390	0.176	O54891.pdb.gz	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
7	AFDB:O08573	0.905	0.355	2.412E-14	353	0.397	0.153	O08573.pdb.gz	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
8	AFDB:Q6DGJ1	0.908	0.889	3.115E-14	139	0.316	0.309	Q6DGJ1.pdb.gz	GRIFN_DANRE Grifin OS=Danio rerio OX=7955 GN=grifin PE=1 SV=1
9	AFDB:P97840	0.906	0.354	4.235E-14	354	0.404	0.155	P97840.pdb.gz	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
10	AFDB:Q91VD1	0.946	0.418	4.457E-14	314	0.331	0.143	Q91VD1.pdb.gz	LEG12_MOUSE Galectin-12 OS=Mus musculus OX=10090 GN=Lgals12 PE=1 SV=2
11	AFDB:Q96DT0	0.956	0.394	5.197E-14	336	0.338	0.137	Q96DT0.pdb.gz	LEG12_HUMAN Galectin-12 OS=Homo sapiens OX=9606 GN=LGALS12 PE=1 SV=1
12	PDB:6ljqA	0.918	0.893	1.856E-12	140	0.309	0.300	6ljqA.pdb.gz	Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity.
13	PDB:6l6aA	0.904	0.868	2.655E-12	142	0.279	0.268	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
14	PDB:3vv1A	0.898	0.867	4.662E-12	141	0.301	0.291	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
15	PDB:5xg7A	0.888	0.870	5.721E-12	139	0.301	0.295	5xg7A.pdb.gz
16	PDB:1w6mA	0.851	0.863	2.056E-11	134	0.331	0.336	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
17	PDB:6k2zA	0.732	0.722	9.069E-11	138	0.287	0.283	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.
18	PDB:5dg2B	0.827	0.857	1.366E-10	131	0.257	0.267	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
19	PDB:4ga9A	0.851	0.862	1.764E-10	134	0.301	0.306	4ga9A.pdb.gz	Gal-1 structure analysis
20	PDB:6e20B	0.841	0.859	7.022E-10	133	0.272	0.278	6e20B.pdb.gz	Structure of the zebrafish galectin-1-L2 and model of its interaction with the infectious hematopoietic necrosis virus (IHNV) envelope glycoprotein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47929	9.18e-97	276	136	1.000	1.000	LEG7_HUMAN Galectin-7 OS=Homo sapiens OX=9606 GN=LGALS7 PE=1 SV=2
2	O54974	8.15e-77	225	136	0.787	0.787	LEG7_MOUSE Galectin-7 OS=Mus musculus OX=10090 GN=Lgals7 PE=2 SV=3
3	Q8K419	3.13e-31	115	326	0.375	0.156	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
4	O54891	7.30e-31	114	301	0.390	0.176	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
5	P56470	9.84e-29	108	323	0.382	0.161	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
6	P97840	3.61e-25	99.8	354	0.412	0.158	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
7	O08573	3.67e-25	99.8	353	0.397	0.153	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
8	Q8I4A5	2.79e-24	94.7	221	0.353	0.217	Q8I4A5_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-3 PE=1 SV=1
9	Q6DGJ1	2.93e-24	92.8	139	0.316	0.309	GRIFN_DANRE Grifin OS=Danio rerio OX=7955 GN=grifin PE=1 SV=1
10	J3KS82	3.84e-24	93.2	175	0.360	0.280	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
11	Q95ZI4	7.18e-24	95.1	285	0.353	0.168	Q95ZI4_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-3 PE=1 SV=1
12	Q09581	1.05e-23	95.1	297	0.353	0.162	LEC3_CAEEL 32 kDa beta-galactoside-binding lectin lec-3 OS=Caenorhabditis elegans OX=6239 GN=lec-3 PE=2 SV=3
13	Q8I4A4	1.30e-23	95.1	312	0.353	0.154	Q8I4A4_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-3 PE=1 SV=1
14	I2HAG1	1.51e-23	95.1	337	0.353	0.142	I2HAG1_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-3 PE=1 SV=1
15	O44126	2.78e-23	93.6	283	0.346	0.166	LEG1_HAECO 32 kDa beta-galactoside-binding lectin OS=Haemonchus contortus OX=6289 GN=GAL-1 PE=1 SV=1
16	J3QSH0	5.37e-23	90.5	175	0.346	0.269	J3QSH0_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
17	P36573	2.11e-22	91.3	279	0.338	0.165	LEC1_CAEEL 32 kDa beta-galactoside-binding lectin OS=Caenorhabditis elegans OX=6239 GN=lec-1 PE=1 SV=1
18	O45904	2.20e-22	91.3	285	0.338	0.161	O45904_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-1 PE=1 SV=1
19	J3KT17	2.84e-22	90.1	234	0.346	0.201	J3KT17_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
20	J3KSY2	4.94e-22	90.9	323	0.382	0.161	J3KSY2_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00337 Gal-bind_lectin	9.4e-34	127.3	Galactoside-binding lectin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313571	0.929	Lectin, galactoside-binding, soluble, 7B
2	9606.ENSP00000332973	0.747	Mothers against decapentaplegic homolog 3
3	9606.ENSP00000419485	0.704	Germinal center-associated signaling and motility protein
4	9606.ENSP00000382595	0.686	Multifunctional protein ADE2
5	9606.ENSP00000392028	0.653	Chromodomain-helicase-DNA-binding protein 7
6	9606.ENSP00000265643	0.537	Galanin peptides

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.999	carbohydrate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.743	biological regulation
GO:0050789	0.719	regulation of biological process
GO:0098742	0.682	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0007157	0.673	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0050794	0.480	regulation of cellular process
GO:0008152	0.367	metabolic process
GO:0048518	0.319	positive regulation of biological process
GO:0048519	0.313	negative regulation of biological process
GO:0050896	0.312	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0043227	0.996	membrane-bounded organelle
GO:0005615	0.992	extracellular space
GO:0031982	0.992	vesicle
GO:1903561	0.968	extracellular vesicle
GO:0005622	0.955	intracellular anatomical structure
GO:0016020	0.949	membrane
GO:0070062	0.944	extracellular exosome
GO:0071944	0.932	cell periphery
GO:0005829	0.916	cytosol
GO:0043231	0.726	intracellular membrane-bounded organelle
GO:0005886	0.582	plasma membrane
GO:0005634	0.457	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]