StarFunc result for job id P47974

User Input

>input (494 residues)
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHPAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSENGDRSQHLLHLQQQQKGGGGSQINSTRYKTELCRPFEESGTCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
SSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCAN
NAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQGLAPPAQPPAPPSATLPAG
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPG
RRLPIFSRLSISDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47974	0.999	0.999	2.099E-75	494	1.000	1.000	P47974.pdb.gz	TISD_HUMAN mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3
2	AFDB:Q5ISE2	0.153	0.105	9.196E-17	725	0.283	0.193	Q5ISE2.pdb.gz	Z36L3_MOUSE mRNA decay activator protein ZFP36L3 OS=Mus musculus OX=10090 GN=Zfp36l3 PE=1 SV=1
3	AFDB:Q9P2N5	0.077	0.042	1.128E-2	1060	0.174	0.081	Q9P2N5.pdb.gz	RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2
4	AFDB:O35867	0.073	0.040	1.129E-1	1095	0.154	0.069	O35867.pdb.gz	NEB1_RAT Neurabin-1 OS=Rattus norvegicus OX=10116 GN=Ppp1r9a PE=1 SV=1
5	AFDB:Q9LVX1	0.063	0.048	1.129E-1	908	0.150	0.081	Q9LVX1.pdb.gz	C3H41_ARATH Zinc finger CCCH domain-containing protein 41 OS=Arabidopsis thaliana OX=3702 GN=At3g27700 PE=1 SV=1
6	AFDB:O74463	0.102	0.095	1.375E-1	547	0.144	0.130	O74463.pdb.gz	YQC1_SCHPO Uncharacterized protein C1739.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1739.01 PE=1 SV=2
7	AFDB:A0A1D8PL89	0.062	0.059	2.180E-1	629	0.148	0.116	A0A1D8PL89.pdb.gz	A0A1D8PL89_CANAL Zcf21p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF21 PE=4 SV=1
8	AFDB:M9PE32	0.076	0.042	2.836E-1	1314	0.184	0.069	M9PE32.pdb.gz	M9PE32_DROME Fife, isoform D OS=Drosophila melanogaster OX=7227 GN=Fife PE=1 SV=1
9	AFDB:P43079	0.076	0.061	3.455E-1	656	0.142	0.107	P43079.pdb.gz	CPH1_CANAL Transcription factor CPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CPH1 PE=1 SV=3
10	PDB:6ff4t	0.055	0.138	4.213E-1	172	0.036	0.105	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	AFDB:Q38EF1	0.083	0.073	4.801E-1	576	0.172	0.148	Q38EF1.pdb.gz	Q38EF1_TRYB2 WASH1 WAHD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0100 PE=3 SV=1
12	PDB:5gm6a	0.051	0.189	8.688E-1	123	0.016	0.065	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:6id0O	0.063	0.096	9.279E-1	290	0.026	0.045	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:7dvqM	0.062	0.123	1.058	191	0.047	0.120	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:7abiP	0.058	0.104	1.914	237	0.028	0.059	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
16	PDB:7c06A	0.048	0.120	3.460	193	0.018	0.047	7c06A.pdb.gz	Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23949	0.0	603	484	0.836	0.853	TISD_MOUSE mRNA decay activator protein ZFP36L2 OS=Mus musculus OX=10090 GN=Zfp36l2 PE=1 SV=2
2	P47974	0.0	974	494	1.000	1.000	TISD_HUMAN mRNA decay activator protein ZFP36L2 OS=Homo sapiens OX=9606 GN=ZFP36L2 PE=1 SV=3
3	Q7ZXW9	4.87e-125	370	363	0.545	0.741	TISDA_XENLA mRNA decay activator protein ZFP36L2-A OS=Xenopus laevis OX=8355 GN=zfp36l2-A PE=1 SV=1
4	Q805B4	1.66e-121	362	364	0.543	0.736	TISDB_XENLA mRNA decay activator protein ZFP36L2-B OS=Xenopus laevis OX=8355 GN=zfp36l2-B PE=1 SV=1
5	Q07352	8.24e-66	217	338	0.289	0.423	TISB_HUMAN mRNA decay activator protein ZFP36L1 OS=Homo sapiens OX=9606 GN=ZFP36L1 PE=1 SV=1
6	P23950	3.53e-65	216	338	0.294	0.429	TISB_MOUSE mRNA decay activator protein ZFP36L1 OS=Mus musculus OX=10090 GN=Zfp36l1 PE=1 SV=1
7	P17431	4.32e-65	216	338	0.294	0.429	TISB_RAT mRNA decay activator protein ZFP36L1 OS=Rattus norvegicus OX=10116 GN=Zfp36l1 PE=1 SV=1
8	Q5ISE2	4.54e-49	181	725	0.314	0.214	Z36L3_MOUSE mRNA decay activator protein ZFP36L3 OS=Mus musculus OX=10090 GN=Zfp36l3 PE=1 SV=1
9	P47980	5.85e-39	149	436	0.119	0.135	TIS11_DROME Protein TIS11 OS=Drosophila melanogaster OX=7227 GN=Tis11 PE=2 SV=2
10	P26651	7.86e-30	121	326	0.136	0.206	TTP_HUMAN mRNA decay activator protein ZFP36 OS=Homo sapiens OX=9606 GN=ZFP36 PE=1 SV=1
11	Q54MG5	3.08e-29	121	437	0.103	0.117	Q54MG5_DICDI C3H1-type domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285973 PE=4 SV=2
12	P22893	2.89e-28	116	319	0.121	0.188	TTP_MOUSE mRNA decay activator protein ZFP36 OS=Mus musculus OX=10090 GN=Zfp36 PE=1 SV=1
13	P47973	1.52e-27	114	320	0.121	0.188	TTP_RAT mRNA decay activator protein ZFP36 OS=Rattus norvegicus OX=10116 GN=Zfp36 PE=1 SV=1
14	Q7YXD9	1.68e-25	110	419	0.089	0.105	Q7YXD9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=1 SV=1
15	Q20155	1.88e-25	110	460	0.089	0.096	Q20155_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=4 SV=3
16	P47979	1.41e-21	99.0	404	0.079	0.097	ZFS1_SCHPO Zinc finger protein zfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zfs1 PE=1 SV=1
17	Q9C9F5	3.07e-21	96.3	308	0.081	0.130	C3H15_ARATH Zinc finger CCCH domain-containing protein 15 OS=Arabidopsis thaliana OX=3702 GN=C3H15 PE=1 SV=1
18	Q9C9N3	1.40e-20	94.4	310	0.081	0.129	C3H14_ARATH Zinc finger CCCH domain-containing protein 14 OS=Arabidopsis thaliana OX=3702 GN=C3H14 PE=2 SV=1
19	P47976	5.23e-18	87.0	325	0.073	0.111	CTH1_YEAST mRNA decay factor CTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTH1 PE=1 SV=2
20	G5ECB9	2.14e-17	87.0	494	0.079	0.079	G5ECB9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mex-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04553 Tis11B_N	1.6e-44	162.8	Tis11B like protein, N terminus
2	PF16131 Torus	55	15.9	Torus domain
3	PF00642 zf-CCCH	6.2e-18	75.5	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
4	PF14608 zf-CCCH_2	0.02	26.7	RNA-binding, Nab2-type zinc finger
5	PF18044 zf-CCCH_4	0.019	26.0	CCCH-type zinc finger
6	PF18345 zf_CCCH_4	1.3e-08	45.9	Zinc finger domain
7	PF19242 Zn_finger_prot	8e+02	11.2	Putative zinc finger protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282388

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349689	0.910	Palmitoyltransferase ZDHHC9
2	9606.ENSP00000350378	0.907	Golgin subfamily A member 7
3	9606.ENSP00000388402	0.829	mRNA decay activator protein ZFP36L1
4	9606.ENSP00000356070	0.819	MAP kinase-activated protein kinase 2
5	9606.ENSP00000320949	0.676	CCR4-NOT transcription complex subunit 1
6	9606.ENSP00000352956	0.647	Probable RNA-binding protein 23
7	9606.ENSP00000282486	0.575	Muscleblind-like protein 1
8	9606.ENSP00000351108	0.563	Heterogeneous nuclear ribonucleoprotein A/B
9	9606.ENSP00000448323	0.545	Transcription factor IIIB 90 kDa subunit
10	9606.ENSP00000340454	0.541	Rap1 GTPase-GDP dissociation stimulator 1
11	9606.ENSP00000313199	0.537	Heterogeneous nuclear ribonucleoprotein D0
12	9606.ENSP00000381216	0.513	Far upstream element-binding protein 2
13	9606.ENSP00000296127	0.512	Palmitoyltransferase ZDHHC3
14	9606.ENSP00000287169	0.507	Palmitoyltransferase ZDHHC5
15	9606.ENSP00000385269	0.504	ELAV-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035925	1.000	mRNA 3'-UTR AU-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0010468	0.987	regulation of gene expression
GO:0043488	0.970	regulation of mRNA stability
GO:0061014	0.970	positive regulation of mRNA catabolic process
GO:0006417	0.968	regulation of translation
GO:0051172	0.967	negative regulation of nitrogen compound metabolic process
GO:0031324	0.966	negative regulation of cellular metabolic process
GO:0010629	0.961	negative regulation of gene expression
GO:0010558	0.960	negative regulation of macromolecule biosynthetic process
GO:0031327	0.960	negative regulation of cellular biosynthetic process
GO:0017148	0.952	negative regulation of translation
GO:0061157	0.923	mRNA destabilization
GO:0050896	0.920	response to stimulus
GO:0071704	0.915	organic substance metabolic process
GO:0044238	0.910	primary metabolic process
GO:0044237	0.910	cellular metabolic process
GO:0007154	0.904	cell communication
GO:0023052	0.893	signaling
GO:0006807	0.892	nitrogen compound metabolic process
GO:0051716	0.882	cellular response to stimulus
GO:0043170	0.793	macromolecule metabolic process
GO:0009719	0.775	response to endogenous stimulus
GO:0071495	0.661	cellular response to endogenous stimulus
GO:0007165	0.489	signal transduction
GO:0034641	0.463	cellular nitrogen compound metabolic process
GO:0006139	0.453	nucleobase-containing compound metabolic process
GO:0090304	0.425	nucleic acid metabolic process
GO:0044260	0.417	cellular macromolecule metabolic process
GO:0035556	0.340	intracellular signal transduction
GO:0070848	0.323	response to growth factor
GO:0016070	0.319	RNA metabolic process
GO:0071363	0.311	cellular response to growth factor stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.965	cytosol
GO:0032991	0.928	protein-containing complex
GO:0070013	0.430	intracellular organelle lumen
GO:0016020	0.320	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]