StarFunc result for job id P47985

User Input

>input (274 residues)
MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47985	1.000	1.000	1.568E-54	274	1.000	1.000	P47985.pdb.gz	UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2
2	AFDB:P20788	0.722	0.722	6.589E-50	274	0.898	0.898	P20788.pdb.gz	UCRI_RAT Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrfs1 PE=1 SV=2
3	AFDB:Q9VQ29	0.713	0.845	1.559E-34	230	0.522	0.622	Q9VQ29.pdb.gz	Q9VQ29_DROME Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Drosophila melanogaster OX=7227 GN=RFeSP PE=1 SV=3
4	AFDB:O44512	0.702	0.697	7.844E-32	276	0.449	0.446	O44512.pdb.gz	O44512_CAEEL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=isp-1 PE=1 SV=1
5	AFDB:A0A1D8PJX3	0.670	0.854	2.065E-30	213	0.409	0.526	A0A1D8PJX3.pdb.gz	A0A1D8PJX3_CANAL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIP1 PE=1 SV=1
6	AFDB:Q09154	0.647	0.773	7.448E-30	228	0.409	0.491	Q09154.pdb.gz	UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rip1 PE=2 SV=2
7	AFDB:P08067	0.663	0.839	1.174E-28	215	0.380	0.484	P08067.pdb.gz	UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIP1 PE=1 SV=1
8	AFDB:P49727	0.618	0.620	1.335E-28	273	0.427	0.429	P49727.pdb.gz	UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays OX=4577 PE=2 SV=1
9	AFDB:Q9LYR2	0.603	0.603	2.702E-28	274	0.387	0.387	Q9LYR2.pdb.gz	UCRI2_ARATH Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-2 PE=1 SV=1
10	AFDB:P49729	0.598	0.634	6.632E-28	258	0.394	0.419	P49729.pdb.gz	UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum OX=4097 PE=2 SV=1
11	PDB:6giqE	0.587	0.835	4.758E-27	185	0.365	0.541	6giqE.pdb.gz	Cryo-EM structure of the yeast respiratory supercomplex.
12	PDB:7rjaC	0.601	0.887	1.547E-22	181	0.387	0.586	7rjaC.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
13	PDB:7e1vM	0.330	0.246	2.219E-5	378	0.091	0.066	7e1vM.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
14	PDB:4qdcA	0.271	0.208	4.239E-4	369	0.084	0.062	4qdcA.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
15	PDB:2qpzA	0.274	0.634	4.819E-4	103	0.091	0.243	2qpzA.pdb.gz	Determining Rieske cluster reduction potentials.
16	PDB:4nbbE	0.291	0.612	5.139E-4	114	0.084	0.202	4nbbE.pdb.gz	Structural basis of the divergent oxygenation reactions catalyzed by the rieske nonheme iron oxygenase carbazole 1,9a-dioxygenase.
17	PDB:2bmoA	0.294	0.193	1.109E-3	437	0.095	0.059	2bmoA.pdb.gz	Structural insight into the dioxygenation of nitroarene compounds: the crystal structure of nitrobenzene dioxygenase.
18	PDB:2zylA	0.260	0.206	1.261E-3	359	0.091	0.070	2zylA.pdb.gz	Characterization of 3-ketosteroid 9{alpha}-hydroxylase, a Rieske oxygenase in the cholesterol degradation pathway of Mycobacterium tuberculosis
19	PDB:1eg9A	0.295	0.188	2.107E-3	447	0.069	0.043	1eg9A.pdb.gz	Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
20	PDB:4qdfB	0.251	0.200	2.903E-3	357	0.091	0.070	4qdfB.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47985	0.0	561	274	1.000	1.000	UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2
2	P20788	1.01e-177	492	274	0.898	0.898	UCRI_RAT Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrfs1 PE=1 SV=2
3	Q9CR68	3.61e-176	488	274	0.887	0.887	UCRI_MOUSE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrfs1 PE=1 SV=1
4	Q9VQ29	1.24e-92	275	230	0.493	0.587	Q9VQ29_DROME Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Drosophila melanogaster OX=7227 GN=RFeSP PE=1 SV=3
5	A0A1D8PJX3	7.36e-81	244	213	0.391	0.502	A0A1D8PJX3_CANAL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIP1 PE=1 SV=1
6	O44512	1.62e-77	238	276	0.489	0.486	O44512_CAEEL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=isp-1 PE=1 SV=1
7	P08067	6.81e-76	232	215	0.376	0.479	UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIP1 PE=1 SV=1
8	Q09154	2.66e-75	231	228	0.383	0.461	UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rip1 PE=2 SV=2
9	P49729	2.69e-66	209	258	0.332	0.353	UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum OX=4097 PE=2 SV=1
10	P49727	5.68e-65	206	273	0.328	0.330	UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays OX=4577 PE=2 SV=1
11	Q9LYR2	3.75e-63	201	274	0.318	0.318	UCRI2_ARATH Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-2 PE=1 SV=1
12	Q94JS0	4.44e-63	201	272	0.314	0.316	UCRI1_ARATH Cytochrome b-c1 complex subunit Rieske-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-1 PE=1 SV=1
13	Q38D40	9.09e-38	136	297	0.252	0.232	Q38D40_TRYB2 Reiske iron-sulfur protein, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4700 PE=3 SV=1
14	Q9ZR03	5.02e-09	57.4	229	0.091	0.109	UCRIA_ARATH Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=petC PE=1 SV=1
15	Q7X9A6	3.34e-08	55.1	222	0.095	0.117	UCRIA_WHEAT Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Triticum aestivum OX=4565 GN=petC PE=2 SV=1
16	A8J9Y1	3.59e-08	54.7	206	0.095	0.126	A8J9Y1_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_11g467689v5 PE=1 SV=1
17	P9WH23	0.17	35.4	429	0.131	0.084	QCRA_MYCTU Cytochrome bc1 complex Rieske iron-sulfur subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qcrA PE=1 SV=1
18	Q583C8	0.87	33.5	1243	0.069	0.015	Q583C8_TRYB2 ATP pyrophosphate-lyase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.1090 PE=4 SV=1
19	O73613	0.95	33.5	616	0.088	0.039	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1
20	Q03132	0.95	33.5	3567	0.058	0.004	ERYA2_SACER 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 OS=Saccharopolyspora erythraea OX=1836 GN=eryA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00355 Rieske	2.3e-08	45.2	Rieske [2Fe-2S] domain
2	PF04265 TPK_B1_binding	3.4e+02	12.3	Thiamin pyrophosphokinase, vitamin B1 binding domain
3	PF09165 Ubiq-Cytc-red_N	1.1e-19	82.2	Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
4	PF02921 UCR_TM	1.4e-26	103.9	Ubiquinol cytochrome reductase transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306397

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203407	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
2	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
3	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
4	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
5	9606.ENSP00000307786	0.999	Cytochrome c
6	9606.ENSP00000309565	0.999	Cytochrome b-c1 complex subunit 6, mitochondrial
7	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
8	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
9	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
10	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
11	9606.ENSP00000332887	0.999	Cytochrome b-c1 complex subunit 9
12	9606.ENSP00000354554	0.999	Cytochrome b
13	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
14	9606.ENSP00000362873	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
15	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
16	9606.ENSP00000425759	0.999	Cytochrome c oxidase subunit 7C, mitochondrial
17	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
18	9606.ENSP00000258424	0.998	Cytochrome c oxidase subunit 5B, mitochondrial
19	9606.ENSP00000296684	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
20	9606.ENSP00000392709	0.998	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.996	catalytic activity
GO:0005515	0.996	protein binding
GO:0009055	0.984	electron transfer activity
GO:0015399	0.975	primary active transmembrane transporter activity
GO:0015453	0.974	oxidoreduction-driven active transmembrane transporter activity
GO:0016679	0.959	oxidoreductase activity, acting on diphenols and related substances as donors
GO:0015078	0.952	proton transmembrane transporter activity
GO:0008121	0.932	ubiquinol-cytochrome-c reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0006091	0.980	generation of precursor metabolites and energy
GO:0015980	0.970	energy derivation by oxidation of organic compounds
GO:0045333	0.941	cellular respiration
GO:0007005	0.917	mitochondrion organization
GO:0065003	0.788	protein-containing complex assembly
GO:0033108	0.645	mitochondrial respiratory chain complex assembly
GO:0017004	0.615	cytochrome complex assembly
GO:0022900	0.443	electron transport chain
GO:0022904	0.337	respiratory electron transport chain
GO:0009060	0.329	aerobic respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098800	0.999	inner mitochondrial membrane protein complex
GO:1990204	0.998	oxidoreductase complex
GO:0098803	0.998	respiratory chain complex
GO:0005746	0.998	mitochondrial respirasome
GO:1902495	0.997	transmembrane transporter complex
GO:0070069	0.982	cytochrome complex
GO:0005750	0.970	mitochondrial respiratory chain complex III
GO:0070013	0.513	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.984	Oxidoreductases.
EC:7.-.-.-	0.975	Translocases.
EC:1.10.-.-	0.959	Acting on diphenols and related substances as donors.
RHEA:11484	0.932	a quinol + 2 Fe(III)-[cytochrome c](out) = a quinone + 2 Fe(II)-[cytochrome c](out) + 2 H(+)(out)
EC:7.1.1.8	0.932	quinol--cytochrome-c reductase.

[back to server]