StarFunc result for job id P47989

User Input

>input (1333 residues)
MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTMEEIENAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCC
MNQKKDHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQAS
TLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFG
AACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGGNIITASPISD
LNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKE
ELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLD
PTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDK
VTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDL
KKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKM
LGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKL
EGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGA
LLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVT
GVPENCKPWSVRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1fo4A	0.965	0.990	0.000	1299	0.875	0.898	1fo4A.pdb.gz	Crystal structures of bovine milk xanthine dehydrogenase and xanthine oxidase: structure-based mechanism of conversion.
2	PDB:2ckjA	0.938	0.988	0.000	1264	0.940	0.991	2ckjA.pdb.gz	Human Milk Xanthine Dehydrogenase is Incompletely Converted to the Oxidase Form in the Absence of Proteolysis. A Structural Explanation.
3	PDB:2e1qA	0.979	0.999	0.000	1307	0.980	0.999	2e1qA.pdb.gz	Human xanthine oxidase changes its substrate specificity to aldehyde oxidase type upon mutation of amino acid residues in the active site: roles of active site residues in binding and activation of purine substrate
4	PDB:3ax7A	0.909	0.989	0.000	1225	0.830	0.903	3ax7A.pdb.gz	Protein conformational gating of enzymatic activity in xanthine oxidoreductase
5	PDB:3zyvB	0.936	0.988	0.000	1262	0.491	0.518	3zyvB.pdb.gz	The First Mammalian Aldehyde Oxidase Crystal Structure: Insights Into Substrate Specificity.
6	PDB:7orcB	0.958	0.983	0.000	1299	0.496	0.509	7orcB.pdb.gz	Interrogating the Inhibition Mechanisms of Human Aldehyde Oxidase by X-ray Crystallography and NMR Spectroscopy: The Raloxifene Case.
7	PDB:7px0B	0.863	0.917	0.000	1253	0.281	0.298	7px0B.pdb.gz	Drosophila melanogaster's Aldehyde Oxidase 1: The First Invertebrate AOX structure
8	AFDB:G3X982	0.975	0.973	0.000	1335	0.503	0.502	G3X982.pdb.gz	AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus OX=10090 GN=Aox3 PE=1 SV=1
9	AFDB:M1ZMM0	0.984	0.982	0.000	1336	0.514	0.513	M1ZMM0.pdb.gz	M1ZMM0_DANRE Xanthine dehydrogenase/oxidase OS=Danio rerio OX=7955 GN=aox3 PE=1 SV=1
10	AFDB:O23887	0.870	0.854	0.000	1358	0.322	0.316	O23887.pdb.gz	ALDO1_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays OX=4577 GN=AO1 PE=1 SV=1
11	AFDB:O54754	0.975	0.975	0.000	1333	0.497	0.497	O54754.pdb.gz	AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus OX=10090 GN=Aox1 PE=1 SV=2
12	AFDB:P10351	0.976	0.975	0.000	1335	0.525	0.524	P10351.pdb.gz	XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ry PE=2 SV=2
13	AFDB:P47989	1.000	1.000	0.000	1333	1.000	1.000	P47989.pdb.gz	XDH_HUMAN Xanthine dehydrogenase/oxidase OS=Homo sapiens OX=9606 GN=XDH PE=1 SV=4
14	AFDB:P47990	0.978	0.960	0.000	1358	0.733	0.719	P47990.pdb.gz	XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus OX=9031 GN=XDH PE=1 SV=1
15	AFDB:P80457	0.997	0.998	0.000	1332	0.896	0.896	P80457.pdb.gz	XDH_BOVIN Xanthine dehydrogenase/oxidase OS=Bos taurus OX=9913 GN=XDH PE=1 SV=4
16	AFDB:Q00519	0.998	0.997	0.000	1335	0.892	0.891	Q00519.pdb.gz	XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus OX=10090 GN=Xdh PE=1 SV=5
17	AFDB:Q06278	0.982	0.978	0.000	1338	0.500	0.498	Q06278.pdb.gz	AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens OX=9606 GN=AOX1 PE=1 SV=2
18	PDB:5g5gC	0.473	0.841	4.337E-53	731	0.132	0.241	5g5gC.pdb.gz	The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
19	PDB:3hrdA	0.287	0.870	6.140E-38	420	0.097	0.307	3hrdA.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase
20	PDB:3hrdB	0.209	0.801	9.015E-20	330	0.068	0.273	3hrdB.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F4JLI5	1149	1353	0.473	0.466	XDH2_ARATH Xanthine dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=XDH2 PE=2 SV=1
2	G3X982	1306	1335	0.504	0.503	AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus OX=10090 GN=Aox3 PE=1 SV=1
3	M1ZMM0	1374	1336	0.517	0.516	M1ZMM0_DANRE Xanthine dehydrogenase/oxidase OS=Danio rerio OX=7955 GN=aox3 PE=1 SV=1
4	O23887	584	1358	0.330	0.324	ALDO1_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays OX=4577 GN=AO1 PE=1 SV=1
5	O54754	1318	1333	0.496	0.496	AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus OX=10090 GN=Aox1 PE=1 SV=2
6	P10351	1400	1335	0.524	0.523	XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster OX=7227 GN=ry PE=2 SV=2
7	P22985	2482	1331	0.903	0.905	XDH_RAT Xanthine dehydrogenase/oxidase OS=Rattus norvegicus OX=10116 GN=Xdh PE=1 SV=3
8	P47989	2774	1333	1.000	1.000	XDH_HUMAN Xanthine dehydrogenase/oxidase OS=Homo sapiens OX=9606 GN=XDH PE=1 SV=4
9	P47990	2031	1358	0.734	0.721	XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus OX=9031 GN=XDH PE=1 SV=1
10	P80457	2459	1332	0.896	0.897	XDH_BOVIN Xanthine dehydrogenase/oxidase OS=Bos taurus OX=9913 GN=XDH PE=1 SV=4
11	Q00519	2467	1335	0.893	0.891	XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus OX=10090 GN=Xdh PE=1 SV=5
12	Q06278	1329	1338	0.503	0.501	AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens OX=9606 GN=AOX1 PE=1 SV=2
13	Q12553	1180	1363	0.468	0.458	XDH_EMENI Xanthine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hxA PE=2 SV=2
14	Q7G191	610	1337	0.334	0.333	ALDO4_ARATH Aldehyde oxidase 4 OS=Arabidopsis thaliana OX=3702 GN=AAO4 PE=1 SV=2
15	Q7G192	651	1321	0.339	0.342	ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO2 PE=1 SV=2
16	Q7G193	595	1368	0.337	0.328	ALDO1_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana OX=3702 GN=AAO1 PE=1 SV=2
17	Q8GUQ8	1183	1361	0.483	0.473	XDH1_ARATH Xanthine dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=XDH1 PE=1 SV=1
18	Q960A1	716	1257	0.351	0.372	GAD3_CAEEL Probable aldehyde oxidase gad-3 OS=Caenorhabditis elegans OX=6239 GN=gad-3 PE=3 SV=3
19	Q9ESH4	1293	1336	0.501	0.500	Q9ESH4_MOUSE aldehyde oxidase OS=Mus musculus OX=10090 GN=Aox3 PE=2 SV=1
20	Q9Z0U5	1316	1333	0.500	0.500	AOXA_RAT Aldehyde oxidase 1 OS=Rattus norvegicus OX=10116 GN=Aox1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01315 Ald_Xan_dh_C	3.5e-32	122.4	Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain
2	PF03450 CO_deh_flav_C	2.5e-21	87.1	CO dehydrogenase flavoprotein C-terminal domain
3	PF00941 FAD_binding_5	1.2e-43	160.3	FAD binding domain in molybdopterin dehydrogenase
4	PF00111 Fer2	1.6e-05	36.0	2Fe-2S iron-sulfur cluster binding domain
5	PF01799 Fer2_2	2.9e-27	105.8	[2Fe-2S] binding domain
6	PF02738 MoCoBD_1	3.2e-94	326.2	Molybdopterin cofactor-binding domain
7	PF20256 MoCoBD_2	3.2e-89	310.9	Molybdopterin cofactor-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244513	0.994	Butyrophilin subfamily 1 member A1
2	9606.ENSP00000238018	0.969	Guanine deaminase
3	9606.ENSP00000354532	0.950	Purine nucleoside phosphorylase
4	9606.ENSP00000312304	0.937	Thiopurine S-methyltransferase
5	9606.ENSP00000298556	0.934	Hypoxanthine-guanine phosphoribosyltransferase
6	9606.ENSP00000261326	0.919	Molybdenum cofactor sulfurase
7	9606.ENSP00000286479	0.913	Arylamine N-acetyltransferase 2
8	9606.ENSP00000342007	0.910	Cytochrome P450 1A2
9	9606.ENSP00000232219	0.908	Retinol-binding protein 1
10	9606.ENSP00000443194	0.908	Arylamine N-acetyltransferase 1
11	9606.ENSP00000266560	0.900	Retinol-binding protein 5
12	9606.ENSP00000301141	0.886	Cytochrome P450 2A6
13	9606.ENSP00000207870	0.847	Xylulose kinase
14	9606.ENSP00000377668	0.847	Sulfite oxidase, mitochondrial
15	9606.ENSP00000252505	0.766	Probable allantoicase
16	9606.ENSP00000362282	0.750	Molybdenum cofactor biosynthesis protein 1
17	9606.ENSP00000349143	0.740	Butyrophilin subfamily 2 member A2
18	9606.ENSP00000241052	0.703	Catalase
19	9606.ENSP00000392762	0.699	L-dopachrome tautomerase
20	9606.ENSP00000333490	0.698	Putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016725	1.000	oxidoreductase activity, acting on CH or CH2 groups
GO:0043167	0.992	ion binding
GO:0042802	0.986	identical protein binding
GO:0097159	0.959	organic cyclic compound binding
GO:1901363	0.957	heterocyclic compound binding
GO:0036094	0.936	small molecule binding
GO:0042803	0.935	protein homodimerization activity
GO:0043546	0.933	molybdopterin cofactor binding
GO:0050660	0.925	flavin adenine dinucleotide binding
GO:0051540	0.905	metal cluster binding
GO:0051537	0.902	2 iron, 2 sulfur cluster binding
GO:0043169	0.851	cation binding
GO:0046872	0.840	metal ion binding
GO:0004854	0.822	xanthine dehydrogenase activity
GO:0046914	0.808	transition metal ion binding
GO:0016903	0.684	oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0016623	0.547	oxidoreductase activity, acting on the aldehyde or oxo group of donors, oxygen as acceptor
GO:0004031	0.328	aldehyde oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0072521	0.995	purine-containing compound metabolic process
GO:0009116	0.983	nucleoside metabolic process
GO:0072523	0.977	purine-containing compound catabolic process
GO:0009112	0.960	nucleobase metabolic process
GO:0034656	0.960	nucleobase-containing small molecule catabolic process
GO:0042278	0.959	purine nucleoside metabolic process
GO:0046128	0.954	purine ribonucleoside metabolic process
GO:0042454	0.945	ribonucleoside catabolic process
GO:0046113	0.940	nucleobase catabolic process
GO:0006144	0.884	purine nucleobase metabolic process
GO:0065007	0.455	biological regulation
GO:0050896	0.380	response to stimulus
GO:0006796	0.333	phosphate-containing compound metabolic process
GO:0009058	0.330	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005576	0.988	extracellular region
GO:0005615	0.956	extracellular space
GO:0043226	0.952	organelle
GO:0043231	0.928	intracellular membrane-bounded organelle
GO:0070013	0.346	intracellular organelle lumen
GO:0070062	0.334	extracellular exosome
GO:0012505	0.320	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.17.-.-	1.000	Acting on CH or CH2 groups.
RHEA:16669	0.822	H2O + NAD(+) + xanthine = H(+) + NADH + urate
EC:1.17.1.4	0.822	xanthine dehydrogenase.
EC:1.2.-.-	0.684	Acting on the aldehyde or oxo group of donors.
EC:1.2.3.-	0.547	With oxygen as acceptor.
RHEA:16829	0.328	an aldehyde + H2O + O2 = a carboxylate + H(+) + H2O2
EC:1.2.3.1	0.328	aldehyde oxidase.

[back to server]