StarFunc result for job id P47992

User Input

>input (114 residues)
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47992	1.000	1.000	7.704E-20	114	1.000	1.000	P47992.pdb.gz	XCL1_HUMAN Lymphotactin OS=Homo sapiens OX=9606 GN=XCL1 PE=1 SV=1
2	AFDB:P47993	0.640	0.640	2.484E-14	114	0.605	0.605	P47993.pdb.gz	XCL1_MOUSE Lymphotactin OS=Mus musculus OX=10090 GN=Xcl1 PE=2 SV=1
3	PDB:1j8iA	0.485	0.579	7.076E-12	93	0.816	1.000	1j8iA.pdb.gz
4	AFDB:P10148	0.481	0.374	4.600E-7	148	0.228	0.176	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
5	AFDB:P14844	0.598	0.473	5.614E-7	148	0.228	0.176	P14844.pdb.gz	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
6	AFDB:O70460	0.614	0.646	6.412E-7	108	0.193	0.204	O70460.pdb.gz	CCL19_MOUSE C-C motif chemokine 19 OS=Mus musculus OX=10090 GN=Ccl19 PE=1 SV=1
7	AFDB:Q99731	0.563	0.650	6.852E-7	98	0.193	0.224	Q99731.pdb.gz	CCL19_HUMAN C-C motif chemokine 19 OS=Homo sapiens OX=9606 GN=CCL19 PE=1 SV=1
8	AFDB:P48298	0.504	0.588	7.825E-7	97	0.202	0.237	P48298.pdb.gz	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
9	AFDB:P80075	0.505	0.578	8.362E-7	99	0.237	0.273	P80075.pdb.gz	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
10	AFDB:P51671	0.506	0.591	1.021E-6	97	0.237	0.278	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
11	AFDB:D4ABS1	0.504	0.584	1.091E-6	98	0.254	0.296	D4ABS1.pdb.gz	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1
12	PDB:1esrA	0.493	0.721	1.565E-5	76	0.193	0.289	1esrA.pdb.gz
13	PDB:2mp1A	0.497	0.705	2.845E-5	77	0.149	0.221	2mp1A.pdb.gz
14	PDB:1bo0A	0.463	0.668	5.527E-5	76	0.202	0.303	1bo0A.pdb.gz
15	PDB:2mpmA	0.468	0.688	7.209E-5	74	0.228	0.351	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
16	PDB:2q8tB	0.446	0.763	8.233E-5	65	0.193	0.338	2q8tB.pdb.gz
17	PDB:2ra4B	0.437	0.747	1.497E-4	65	0.167	0.292	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
18	PDB:1o80A	0.454	0.669	2.229E-4	74	0.105	0.162	1o80A.pdb.gz
19	PDB:2jyoA	0.422	0.665	2.907E-4	70	0.184	0.300	2jyoA.pdb.gz
20	PDB:1nr4E	0.509	0.817	3.107E-4	69	0.149	0.246	1nr4E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47992	5.29e-79	229	114	1.000	1.000	XCL1_HUMAN Lymphotactin OS=Homo sapiens OX=9606 GN=XCL1 PE=1 SV=1
2	Q9UBD3	1.25e-77	226	114	0.982	0.982	XCL2_HUMAN Cytokine SCM-1 beta OS=Homo sapiens OX=9606 GN=XCL2 PE=1 SV=1
3	P47993	9.24e-51	158	114	0.605	0.605	XCL1_MOUSE Lymphotactin OS=Mus musculus OX=10090 GN=Xcl1 PE=2 SV=1
4	P48298	3.23e-11	57.4	97	0.246	0.289	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
5	Q9JKC0	3.60e-11	57.8	119	0.254	0.244	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
6	P80075	1.61e-10	55.5	99	0.219	0.253	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
7	O00175	4.36e-10	55.1	119	0.254	0.244	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
8	P97545	4.47e-10	54.3	97	0.193	0.227	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
9	Q99616	4.77e-10	54.3	98	0.193	0.224	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
10	P51671	6.73e-10	53.9	97	0.219	0.258	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
11	P10148	1.43e-09	54.3	148	0.219	0.169	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
12	P13501	1.38e-08	50.4	91	0.184	0.231	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
13	Q9Y258	1.91e-08	50.1	94	0.219	0.266	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
14	Q9QXY8	2.25e-08	50.1	97	0.228	0.268	CCL7_RAT C-C motif chemokine 7 OS=Rattus norvegicus OX=10116 GN=Ccl7 PE=3 SV=1
15	Q16627	2.37e-08	49.7	93	0.193	0.237	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
16	P80098	3.87e-08	49.3	99	0.193	0.222	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
17	P16619	5.11e-08	48.9	93	0.202	0.247	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
18	P14844	6.73e-08	49.7	148	0.184	0.142	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
19	Q8NHW4	7.76e-08	48.5	92	0.246	0.304	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
20	D4ABS1	1.35e-07	47.8	98	0.193	0.224	D4ABS1_RAT C-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Ccl12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	8.5e-09	46.8	Small cytokines (intecrine/chemokine), interleukin-8 like
2	PF16645 PHtD_u1	83	15.0	Unstructured region on Pneumococcal histidine triad protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310405	0.999	Chemokine XC receptor 1
2	9606.ENSP00000356793	0.909	Cytokine SCM-1 beta
3	9606.ENSP00000246657	0.863	C-C chemokine receptor type 7
4	9606.ENSP00000362795	0.833	C-X-C chemokine receptor type 3
5	9606.ENSP00000292303	0.831	C-C chemokine receptor type 5
6	9606.ENSP00000296140	0.830	C-C chemokine receptor type 1
7	9606.ENSP00000292301	0.814	C-C chemokine receptor type 2
8	9606.ENSP00000441600	0.804	C-C chemokine receptor type 3
9	9606.ENSP00000326432	0.799	C-C chemokine receptor type 8
10	9606.ENSP00000295683	0.781	C-X-C chemokine receptor type 1
11	9606.ENSP00000351059	0.780	CX3C chemokine receptor 1
12	9606.ENSP00000350256	0.774	C-C chemokine receptor type 9
13	9606.ENSP00000308815	0.767	C-C motif chemokine 19
14	9606.ENSP00000319635	0.766	C-X-C chemokine receptor type 2
15	9606.ENSP00000292174	0.765	C-X-C chemokine receptor type 5
16	9606.ENSP00000343952	0.764	Chemokine (C-C motif) receptor 6
17	9606.ENSP00000386884	0.764	C-X-C chemokine receptor type 4
18	9606.ENSP00000395704	0.758	C-X-C chemokine receptor type 6
19	9606.ENSP00000305651	0.749	C-X-C motif chemokine 10
20	9606.ENSP00000481357	0.740	C-C motif chemokine ligand 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0046983	0.555	protein dimerization activity
GO:0042802	0.555	identical protein binding
GO:0042803	0.416	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.994	signaling
GO:0007154	0.994	cell communication
GO:0051716	0.994	cellular response to stimulus
GO:0042221	0.990	response to chemical
GO:0002376	0.989	immune system process
GO:0009605	0.989	response to external stimulus
GO:0048522	0.986	positive regulation of cellular process
GO:0007165	0.982	signal transduction
GO:0006935	0.980	chemotaxis
GO:0048870	0.979	cell motility
GO:0002682	0.978	regulation of immune system process
GO:0030334	0.976	regulation of cell migration
GO:0048583	0.970	regulation of response to stimulus
GO:0050900	0.969	leukocyte migration
GO:0002684	0.968	positive regulation of immune system process
GO:0006950	0.966	response to stress
GO:2000147	0.965	positive regulation of cell motility
GO:0006952	0.962	defense response
GO:0030335	0.960	positive regulation of cell migration
GO:0070887	0.958	cellular response to chemical stimulus
GO:0032101	0.947	regulation of response to external stimulus
GO:0060326	0.946	cell chemotaxis
GO:0048584	0.939	positive regulation of response to stimulus
GO:0032103	0.932	positive regulation of response to external stimulus
GO:0030595	0.930	leukocyte chemotaxis
GO:0002685	0.924	regulation of leukocyte migration
GO:0006959	0.905	humoral immune response
GO:0002687	0.904	positive regulation of leukocyte migration
GO:0001817	0.885	regulation of cytokine production
GO:0032501	0.880	multicellular organismal process
GO:0030155	0.859	regulation of cell adhesion
GO:0001819	0.854	positive regulation of cytokine production
GO:0071674	0.851	mononuclear cell migration
GO:1903037	0.828	regulation of leukocyte cell-cell adhesion
GO:0048523	0.805	negative regulation of cellular process
GO:0042127	0.802	regulation of cell population proliferation
GO:0043269	0.798	regulation of monoatomic ion transport
GO:0008284	0.792	positive regulation of cell population proliferation
GO:0071675	0.788	regulation of mononuclear cell migration
GO:0051241	0.784	negative regulation of multicellular organismal process
GO:0050865	0.784	regulation of cell activation
GO:0071677	0.783	positive regulation of mononuclear cell migration
GO:0051707	0.768	response to other organism
GO:0002697	0.750	regulation of immune effector process
GO:0051282	0.750	regulation of sequestering of calcium ion
GO:2000401	0.745	regulation of lymphocyte migration
GO:0045785	0.743	positive regulation of cell adhesion
GO:0051249	0.707	regulation of lymphocyte activation
GO:0050867	0.698	positive regulation of cell activation
GO:2000403	0.686	positive regulation of lymphocyte migration
GO:0070663	0.681	regulation of leukocyte proliferation
GO:0050863	0.678	regulation of T cell activation
GO:0050776	0.673	regulation of immune response
GO:0002696	0.668	positive regulation of leukocyte activation
GO:0032944	0.665	regulation of mononuclear cell proliferation
GO:0050920	0.664	regulation of chemotaxis
GO:0050670	0.664	regulation of lymphocyte proliferation
GO:0022409	0.641	positive regulation of cell-cell adhesion
GO:0002699	0.626	positive regulation of immune effector process
GO:0051251	0.625	positive regulation of lymphocyte activation
GO:0042129	0.624	regulation of T cell proliferation
GO:1903039	0.620	positive regulation of leukocyte cell-cell adhesion
GO:0002819	0.614	regulation of adaptive immune response
GO:0050870	0.605	positive regulation of T cell activation
GO:0002688	0.598	regulation of leukocyte chemotaxis
GO:0002683	0.593	negative regulation of immune system process
GO:0051050	0.588	positive regulation of transport
GO:0010605	0.586	negative regulation of macromolecule metabolic process
GO:0001906	0.561	cell killing
GO:0002705	0.561	positive regulation of leukocyte mediated immunity
GO:0061844	0.551	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050921	0.547	positive regulation of chemotaxis
GO:0002708	0.529	positive regulation of lymphocyte mediated immunity
GO:0007162	0.515	negative regulation of cell adhesion
GO:0001818	0.513	negative regulation of cytokine production
GO:0031640	0.500	killing of cells of another organism
GO:0002822	0.498	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0046634	0.491	regulation of alpha-beta T cell activation
GO:1903038	0.483	negative regulation of leukocyte cell-cell adhesion
GO:2000404	0.480	regulation of T cell migration
GO:0031341	0.476	regulation of cell killing
GO:0050866	0.476	negative regulation of cell activation
GO:0032649	0.474	regulation of type II interferon production
GO:0051171	0.463	regulation of nitrogen compound metabolic process
GO:0031323	0.459	regulation of cellular metabolic process
GO:0002695	0.456	negative regulation of leukocyte activation
GO:0002709	0.451	regulation of T cell mediated immunity
GO:0032733	0.448	positive regulation of interleukin-10 production
GO:0072676	0.447	lymphocyte migration
GO:0051250	0.435	negative regulation of lymphocyte activation
GO:0007166	0.418	cell surface receptor signaling pathway
GO:0007267	0.416	cell-cell signaling
GO:0002690	0.413	positive regulation of leukocyte chemotaxis
GO:0080134	0.405	regulation of response to stress
GO:0050868	0.402	negative regulation of T cell activation
GO:0006954	0.387	inflammatory response
GO:0002698	0.384	negative regulation of immune effector process
GO:0010033	0.379	response to organic substance
GO:0032689	0.365	negative regulation of type II interferon production
GO:0080090	0.364	regulation of primary metabolic process
GO:0097529	0.362	myeloid leukocyte migration
GO:0002704	0.349	negative regulation of leukocyte mediated immunity
GO:0031347	0.307	regulation of defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.458	extracellular space
GO:0071944	0.411	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]