StarFunc result for job id P48023

User Input

>input (281 residues)
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48023	1.000	1.000	2.310E-45	281	1.000	1.000	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
2	AFDB:P41047	0.538	0.542	3.459E-34	279	0.765	0.771	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
3	AFDB:Q0PKX7	0.538	0.562	2.894E-18	268	0.313	0.328	Q0PKX7.pdb.gz	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
4	AFDB:O95150	0.472	0.527	7.390E-15	251	0.214	0.239	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
5	AFDB:O43557	0.524	0.597	1.537E-14	240	0.210	0.246	O43557.pdb.gz	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
6	AFDB:Q08CQ3	0.479	0.569	2.879E-14	234	0.206	0.248	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
7	AFDB:Q8K3Y7	0.470	0.522	3.739E-14	252	0.210	0.234	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
8	AFDB:Q06599	0.459	0.547	2.590E-13	234	0.203	0.244	Q06599.pdb.gz	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
9	AFDB:P01375	0.459	0.548	3.363E-13	233	0.199	0.240	P01375.pdb.gz	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
10	AFDB:A0A0U5J7B5	0.465	0.448	3.935E-13	292	0.203	0.195	A0A0U5J7B5.pdb.gz	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
11	PDB:7e57B	0.295	0.625	4.603E-6	123	0.085	0.195	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
12	PDB:5h4bA	0.353	0.662	2.454E-5	136	0.057	0.118	5h4bA.pdb.gz
13	PDB:5kc6B	0.354	0.637	1.007E-4	144	0.064	0.125	5kc6B.pdb.gz
14	PDB:7drtB	0.176	0.121	3.719E-3	496	0.053	0.030	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
15	PDB:5hlyA	0.257	0.246	6.612E-3	299	0.043	0.040	5hlyA.pdb.gz
16	PDB:3cl5A	0.216	0.182	1.449E-2	358	0.082	0.064	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.
17	PDB:4fixA	0.137	0.071	2.714E-2	629	0.071	0.032	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:3fxiC	0.166	0.270	2.860E-2	140	0.068	0.136	3fxiC.pdb.gz
19	PDB:6sbpA	0.104	0.116	2.860E-2	241	0.046	0.054	6sbpA.pdb.gz
20	PDB:7bhqB	0.141	0.179	3.013E-2	204	0.096	0.132	7bhqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48023	0.0	568	281	1.000	1.000	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
2	Q0VHD7	0.0	566	281	0.996	0.996	Q0VHD7_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=2 SV=1
3	Q53ZZ1	0.0	568	281	1.000	1.000	Q53ZZ1_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=TNFSF6 PE=2 SV=1
4	P41047	1.09e-140	399	279	0.751	0.756	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
5	P36940	1.17e-128	368	278	0.744	0.752	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
6	Q0PKX7	1.42e-35	130	268	0.288	0.302	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
7	Q9QYH9	1.52e-18	84.3	239	0.178	0.209	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
8	O43557	1.65e-16	79.0	240	0.160	0.188	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
9	Q06332	2.95e-16	77.4	202	0.185	0.257	TNFB_RAT Lymphotoxin-alpha OS=Rattus norvegicus OX=10116 GN=Lta PE=3 SV=1
10	P09225	8.11e-16	76.3	202	0.185	0.257	TNFB_MOUSE Lymphotoxin-alpha OS=Mus musculus OX=10090 GN=Lta PE=2 SV=1
11	Q8K3Y7	1.02e-14	74.3	252	0.167	0.187	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
12	O95150	1.45e-14	73.6	251	0.178	0.199	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
13	P01374	6.88e-14	70.9	205	0.167	0.229	TNFB_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=2
14	Q6FG55	7.68e-14	70.9	205	0.167	0.229	Q6FG55_HUMAN Lymphotoxin-alpha OS=Homo sapiens OX=9606 GN=LTA PE=1 SV=1
15	B3GDZ6	1.13e-12	68.2	232	0.174	0.211	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
16	P23563	1.13e-12	68.2	232	0.174	0.211	TNFA_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNF PE=2 SV=1
17	P50592	4.12e-12	67.4	291	0.206	0.199	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
18	C1K3N5	1.05e-11	65.5	232	0.217	0.263	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
19	P01375	1.35e-11	65.1	233	0.217	0.262	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
20	Q06599	2.97e-11	63.9	234	0.171	0.205	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06923 GutM	5.2e+02	12.2	Glucitol operon activator protein (GutM)
2	PF00229 TNF	1.3e-30	117.4	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301838	0.999	FAS-associated death domain protein
2	9606.ENSP00000347979	0.999	Tumor necrosis factor receptor superfamily member 6
3	9606.ENSP00000351273	0.999	Caspase-8
4	9606.ENSP00000359013	0.998	Tumor necrosis factor receptor superfamily, member 6b, decoy
5	9606.ENSP00000480348	0.997	annotation not available
6	9606.ENSP00000162749	0.991	Tumor necrosis factor receptor superfamily member 1A
7	9606.ENSP00000286186	0.987	Caspase-10
8	9606.ENSP00000318822	0.982	BH3-interacting domain death agonist
9	9606.ENSP00000312455	0.981	CASP8 and FADD-like apoptosis regulator
10	9606.ENSP00000385824	0.970	Forkhead box protein O3
11	9606.ENSP00000394794	0.968	Tyrosine-protein phosphatase non-receptor type 13
12	9606.ENSP00000356042	0.966	Ezrin
13	9606.ENSP00000428056	0.966	Phosphatidylinositol 3-kinase regulatory subunit alpha
14	9606.ENSP00000259808	0.964	Receptor-interacting serine/threonine-protein kinase 1
15	9606.ENSP00000363668	0.963	Death domain-associated protein 6
16	9606.ENSP00000346671	0.960	Tyrosine-protein kinase Fyn
17	9606.ENSP00000358327	0.954	Caspase-7
18	9606.ENSP00000362680	0.953	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000477613	0.953	Baculoviral IAP repeat-containing protein 2
20	9606.ENSP00000351908	0.950	Mitogen-activated protein kinase kinase kinase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.561	cytokine receptor binding
GO:0032813	0.532	tumor necrosis factor receptor superfamily binding
GO:0098772	0.510	molecular function regulator activity
GO:0042802	0.357	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0006915	0.990	apoptotic process
GO:0048522	0.988	positive regulation of cellular process
GO:0007165	0.987	signal transduction
GO:0048583	0.980	regulation of response to stimulus
GO:0010604	0.961	positive regulation of macromolecule metabolic process
GO:0007166	0.959	cell surface receptor signaling pathway
GO:0010941	0.949	regulation of cell death
GO:0097190	0.948	apoptotic signaling pathway
GO:0023051	0.939	regulation of signaling
GO:0010646	0.939	regulation of cell communication
GO:0048519	0.931	negative regulation of biological process
GO:0097191	0.931	extrinsic apoptotic signaling pathway
GO:0009966	0.927	regulation of signal transduction
GO:0048584	0.918	positive regulation of response to stimulus
GO:0080090	0.913	regulation of primary metabolic process
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0043067	0.908	regulation of programmed cell death
GO:0010942	0.908	positive regulation of cell death
GO:0048523	0.902	negative regulation of cellular process
GO:0042981	0.901	regulation of apoptotic process
GO:0043068	0.895	positive regulation of programmed cell death
GO:0009967	0.888	positive regulation of signal transduction
GO:0043065	0.877	positive regulation of apoptotic process
GO:1902533	0.849	positive regulation of intracellular signal transduction
GO:0051247	0.816	positive regulation of protein metabolic process
GO:0071840	0.769	cellular component organization or biogenesis
GO:0008625	0.765	extrinsic apoptotic signaling pathway via death domain receptors
GO:0016043	0.754	cellular component organization
GO:0031323	0.724	regulation of cellular metabolic process
GO:0065009	0.717	regulation of molecular function
GO:0050790	0.691	regulation of catalytic activity
GO:0043085	0.664	positive regulation of catalytic activity
GO:0051336	0.657	regulation of hydrolase activity
GO:0030162	0.633	regulation of proteolysis
GO:0052548	0.623	regulation of endopeptidase activity
GO:0010468	0.604	regulation of gene expression
GO:0042221	0.582	response to chemical
GO:0051239	0.570	regulation of multicellular organismal process
GO:0051345	0.561	positive regulation of hydrolase activity
GO:0002376	0.553	immune system process
GO:0070887	0.541	cellular response to chemical stimulus
GO:0043122	0.539	regulation of I-kappaB kinase/NF-kappaB signaling
GO:2000116	0.492	regulation of cysteine-type endopeptidase activity
GO:0006950	0.491	response to stress
GO:0045862	0.491	positive regulation of proteolysis
GO:0019219	0.470	regulation of nucleobase-containing compound metabolic process
GO:0010950	0.459	positive regulation of endopeptidase activity
GO:0010556	0.458	regulation of macromolecule biosynthetic process
GO:0031326	0.457	regulation of cellular biosynthetic process
GO:0010033	0.453	response to organic substance
GO:2001141	0.447	regulation of RNA biosynthetic process
GO:0006355	0.441	regulation of DNA-templated transcription
GO:0032502	0.412	developmental process
GO:0071310	0.400	cellular response to organic substance
GO:0032501	0.399	multicellular organismal process
GO:0048856	0.356	anatomical structure development
GO:0009605	0.356	response to external stimulus
GO:0051240	0.329	positive regulation of multicellular organismal process
GO:0031325	0.318	positive regulation of cellular metabolic process
GO:2001056	0.316	positive regulation of cysteine-type endopeptidase activity
GO:0043281	0.313	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043123	0.312	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0042127	0.311	regulation of cell population proliferation
GO:0050793	0.309	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.869	intracellular anatomical structure
GO:0043227	0.856	membrane-bounded organelle
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0005829	0.522	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]