StarFunc result for job id P48047

User Input

>input (213 residues)
MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEK
ELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSN
TQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPS
ILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48047	1.000	1.000	1.688E-37	213	1.000	1.000	P48047.pdb.gz	ATPO_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1
2	AFDB:P13621	0.966	0.966	8.458E-35	213	0.878	0.878	P13621.pdb.gz	ATPO_BOVIN ATP synthase subunit O, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PO PE=1 SV=2
3	AFDB:Q06647	0.948	0.948	1.588E-33	213	0.817	0.817	Q06647.pdb.gz	ATPO_RAT ATP synthase subunit O, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5po PE=1 SV=1
4	AFDB:Q24439	0.808	0.823	6.641E-23	209	0.399	0.407	Q24439.pdb.gz	ATPO_DROME ATP synthase subunit O, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynO PE=2 SV=2
5	AFDB:Q7JNG1	0.856	0.801	6.074E-21	228	0.366	0.342	Q7JNG1.pdb.gz	Q7JNG1_CAEEL ATP synthase subunit O, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=atp-3 PE=1 SV=1
6	AFDB:Q96251	0.840	0.754	2.915E-19	238	0.329	0.294	Q96251.pdb.gz	ATPO_ARATH ATP synthase subunit O, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g13450 PE=1 SV=2
7	AFDB:P09457	0.845	0.849	2.827E-17	212	0.329	0.330	P09457.pdb.gz	ATPO_YEAST ATP synthase subunit 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP5 PE=1 SV=1
8	AFDB:O74479	0.722	0.713	3.371E-17	216	0.333	0.329	O74479.pdb.gz	ATPO_SCHPO ATP synthase subunit 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp5 PE=3 SV=2
9	AFDB:Q8IEL5	0.737	0.628	2.586E-15	253	0.235	0.198	Q8IEL5.pdb.gz	Q8IEL5_PLAF7 ATP synthase subunit O, mitochondrial, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1310000 PE=3 SV=1
10	AFDB:Q9SSS9	0.647	0.600	4.317E-14	234	0.197	0.179	Q9SSS9.pdb.gz	ATPD_ARATH ATP synthase subunit delta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPD PE=1 SV=1
11	PDB:6cp6Y	0.761	0.855	7.071E-13	188	0.315	0.356	6cp6Y.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
12	PDB:6oqrW	0.691	0.834	3.445E-12	173	0.216	0.266	6oqrW.pdb.gz	Cryo-EM structures provide insight into how E. coli F1FoATP synthase accommodates symmetry mismatch.
13	PDB:8apaM1	0.522	0.483	5.182E-8	234	0.174	0.158	8apaM1.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
14	PDB:6vq6I	0.258	0.247	2.747E-1	225	0.117	0.111	6vq6I.pdb.gz	Structure of V-ATPase from the mammalian brain.
15	PDB:2npbA	0.213	0.445	5.236E-1	88	0.070	0.170	2npbA.pdb.gz
16	PDB:6z7oA	0.189	0.296	5.236E-1	110	0.038	0.073	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
17	PDB:1r26A	0.150	0.216	7.445E-1	113	0.080	0.150	1r26A.pdb.gz
18	PDB:1wn0C	0.155	0.214	7.445E-1	138	0.070	0.109	1wn0C.pdb.gz
19	PDB:1ghhA	0.156	0.310	8.371E-1	81	0.047	0.123	1ghhA.pdb.gz
20	PDB:1ddbA	0.170	0.179	8.877E-1	195	0.089	0.097	1ddbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48047	6.94e-155	429	213	1.000	1.000	ATPO_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1
2	P13621	4.28e-138	387	213	0.878	0.878	ATPO_BOVIN ATP synthase subunit O, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PO PE=1 SV=2
3	Q9DB20	6.87e-132	371	213	0.822	0.822	ATPO_MOUSE ATP synthase subunit O, mitochondrial OS=Mus musculus OX=10090 GN=Atp5po PE=1 SV=1
4	Q06647	1.18e-129	365	213	0.817	0.817	ATPO_RAT ATP synthase subunit O, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5po PE=1 SV=1
5	Q24439	1.34e-57	182	209	0.408	0.416	ATPO_DROME ATP synthase subunit O, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynO PE=2 SV=2
6	P91283	8.95e-48	157	207	0.394	0.406	P91283_CAEEL ATP synthase subunit O, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=atp-3 PE=1 SV=1
7	Q7JNG1	3.12e-47	157	228	0.394	0.368	Q7JNG1_CAEEL ATP synthase subunit O, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=atp-3 PE=1 SV=1
8	Q96251	6.22e-37	130	238	0.333	0.298	ATPO_ARATH ATP synthase subunit O, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g13450 PE=1 SV=2
9	O74479	5.30e-36	127	216	0.338	0.333	ATPO_SCHPO ATP synthase subunit 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp5 PE=3 SV=2
10	P09457	4.48e-33	120	212	0.310	0.311	ATPO_YEAST ATP synthase subunit 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP5 PE=1 SV=1
11	Q8IEL5	2.80e-21	90.5	253	0.230	0.194	Q8IEL5_PLAF7 ATP synthase subunit O, mitochondrial, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1310000 PE=3 SV=1
12	P0ABA4	3.21e-12	64.7	177	0.211	0.254	ATPD_ECOLI ATP synthase subunit delta OS=Escherichia coli (strain K12) OX=83333 GN=atpH PE=1 SV=1
13	P27180	4.30e-10	58.9	185	0.211	0.243	ATPD_SYNY3 ATP synthase subunit delta OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=atpH PE=3 SV=1
14	Q9SSS9	3.16e-09	57.4	234	0.197	0.179	ATPD_ARATH ATP synthase subunit delta, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPD PE=1 SV=1
15	P9WPV3	9.37e-06	47.8	446	0.183	0.087	ATPFD_MYCTU ATP synthase subunit b-delta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpFH PE=1 SV=1
16	Q54RA8	8.50e-05	44.7	296	0.197	0.142	ATPO_DICDI ATP synthase subunit O, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=atp5po PE=3 SV=1
17	P28693	1.9	32.0	1004	0.146	0.031	EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 GN=EPHB2 PE=1 SV=3
18	B1AKC9	2.2	31.6	946	0.136	0.031	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
19	F1MAJ0	2.5	31.6	987	0.136	0.029	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
20	P29323	5.1	30.4	1055	0.089	0.018	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11867 DUF3387	1.8e+02	12.9	Domain of unknown function (DUF3387)
2	PF00213 OSCP	2.7e-44	162.7	ATP synthase delta (OSCP) subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
3	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
4	9606.ENSP00000300688	0.999	ATP synthase subunit g, mitochondrial
5	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
6	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
7	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
8	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
9	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
10	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
11	9606.ENSP00000243997	0.997	ATP synthase subunit epsilon, mitochondrial
12	9606.ENSP00000354632	0.996	ATP synthase subunit a
13	9606.ENSP00000377033	0.991	ATP synthase F(0) complex subunit C1, mitochondrial
14	9606.ENSP00000358840	0.989	Up-regulated during skeletal muscle growth protein 5
15	9606.ENSP00000296684	0.987	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
16	9606.ENSP00000355265	0.987	ATP synthase protein 8
17	9606.ENSP00000284727	0.985	ATP synthase F(0) complex subunit C3, mitochondrial
18	9606.ENSP00000268379	0.981	Cytochrome b-c1 complex subunit 2, mitochondrial
19	9606.ENSP00000377878	0.973	ATP synthase F(0) complex subunit C2, mitochondrial
20	9606.ENSP00000258424	0.966	Cytochrome c oxidase subunit 5B, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0046933	1.000	proton-transporting ATP synthase activity, rotational mechanism
GO:0005515	0.994	protein binding
GO:0097159	0.967	organic cyclic compound binding
GO:0140657	0.785	ATP-dependent activity
GO:0016787	0.626	hydrolase activity
GO:1901363	0.514	heterocyclic compound binding
GO:1903924	0.514	estradiol binding
GO:0016817	0.460	hydrolase activity, acting on acid anhydrides
GO:0017111	0.453	ribonucleoside triphosphate phosphatase activity
GO:0044877	0.418	protein-containing complex binding
GO:0016887	0.413	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0034641	0.987	cellular nitrogen compound metabolic process
GO:0006754	0.978	ATP biosynthetic process
GO:0015980	0.909	energy derivation by oxidation of organic compounds
GO:0045333	0.901	cellular respiration
GO:0009060	0.763	aerobic respiration
GO:0006119	0.658	oxidative phosphorylation
GO:0015986	0.635	proton motive force-driven ATP synthesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0098800	1.000	inner mitochondrial membrane protein complex
GO:0016469	0.985	proton-transporting two-sector ATPase complex
GO:0045259	0.980	proton-transporting ATP synthase complex
GO:0005753	0.950	mitochondrial proton-transporting ATP synthase complex
GO:0005886	0.927	plasma membrane
GO:0005634	0.888	nucleus
GO:0070013	0.505	intracellular organelle lumen
GO:0031981	0.356	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57720	1.000	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	1.000	H(+)-transporting two-sector ATPase.
EC:3.-.-.-	0.626	Hydrolases.
EC:3.6.-.-	0.460	Acting on acid anhydrides.
RHEA:23680	0.453	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.453	nucleoside-triphosphate phosphatase.
RHEA:13065	0.413	ATP + H2O = ADP + H(+) + phosphate

[back to server]