StarFunc result for job id P48051

User Input

>input (423 residues)
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48542	0.854	0.850	2.561E-78	425	0.983	0.979	P48542.pdb.gz	KCNJ6_MOUSE G protein-activated inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj6 PE=1 SV=1
2	AFDB:F1MYR9	0.785	0.793	3.065E-63	419	0.671	0.678	F1MYR9.pdb.gz	KCNJ5_BOVIN G protein-activated inward rectifier potassium channel 4 OS=Bos taurus OX=9913 GN=KCNJ5 PE=1 SV=2
3	AFDB:P48543	0.780	0.839	2.637E-60	393	0.624	0.672	P48543.pdb.gz	KCNJ9_MOUSE G protein-activated inward rectifier potassium channel 3 OS=Mus musculus OX=10090 GN=Kcnj9 PE=1 SV=2
4	AFDB:E1BNE9	0.761	0.643	1.731E-52	501	0.506	0.427	E1BNE9.pdb.gz	KCNJ3_BOVIN G protein-activated inward rectifier potassium channel 1 OS=Bos taurus OX=9913 GN=KCNJ3 PE=1 SV=1
5	AFDB:F1NHE9	0.791	0.780	1.022E-50	429	0.459	0.452	F1NHE9.pdb.gz	KCJ12_CHICK ATP-sensitive inward rectifier potassium channel 12 OS=Gallus gallus OX=9031 GN=KCNJ12 PE=1 SV=1
6	AFDB:E7F807	0.787	0.791	2.448E-50	421	0.470	0.473	E7F807.pdb.gz	E7F807_DANRE ATP-sensitive inward rectifier potassium channel 12-like OS=Danio rerio OX=7955 GN=kcnj12b PE=3 SV=3
7	AFDB:E7FGH1	0.778	0.771	7.403E-50	427	0.442	0.438	E7FGH1.pdb.gz	E7FGH1_DANRE Inward rectifier potassium channel 2 OS=Danio rerio OX=7955 GN=kcnj2 PE=2 SV=1
8	AFDB:B7U540	0.799	0.781	8.817E-50	433	0.449	0.439	B7U540.pdb.gz	KCJ18_HUMAN Inward rectifier potassium channel 18 OS=Homo sapiens OX=9606 GN=KCNJ18 PE=1 SV=3
9	AFDB:P35561	0.778	0.769	1.579E-49	428	0.473	0.467	P35561.pdb.gz	KCNJ2_MOUSE Inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj2 PE=1 SV=1
10	AFDB:P52190	0.750	0.712	2.239E-49	446	0.463	0.439	P52190.pdb.gz	KCNJ4_RAT Inward rectifier potassium channel 4 OS=Rattus norvegicus OX=10116 GN=Kcnj4 PE=1 SV=1
11	PDB:7tysA	0.761	0.888	2.043E-43	361	0.390	0.457	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
12	PDB:7mjpA	0.646	0.734	1.752E-38	366	0.395	0.456	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
13	PDB:7zdzA	0.616	0.774	7.699E-35	325	0.430	0.560	7zdzA.pdb.gz
14	PDB:1xl6A	0.587	0.826	4.089E-22	291	0.187	0.271	1xl6A.pdb.gz
15	PDB:5a1uE	0.127	0.074	3.634E-3	824	0.054	0.028	5a1uE.pdb.gz
16	PDB:1xo8A	0.162	0.355	5.791E-3	151	0.024	0.066	1xo8A.pdb.gz
17	PDB:6eo1A	0.205	0.240	8.214E-3	355	0.066	0.079	6eo1A.pdb.gz
18	PDB:7wswA	0.209	0.191	9.229E-3	472	0.087	0.078	7wswA.pdb.gz
19	PDB:5dcaA	0.109	0.040	9.782E-3	1948	0.047	0.010	5dcaA.pdb.gz
20	PDB:2agcA	0.149	0.276	1.165E-2	162	0.031	0.080	2agcA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MYR9	0.0	607	419	0.683	0.690	KCNJ5_BOVIN G protein-activated inward rectifier potassium channel 4 OS=Bos taurus OX=9913 GN=KCNJ5 PE=1 SV=2
2	P48051	0.0	880	423	1.000	1.000	KCNJ6_HUMAN G protein-activated inward rectifier potassium channel 2 OS=Homo sapiens OX=9606 GN=KCNJ6 PE=1 SV=1
3	P48542	0.0	868	425	0.983	0.979	KCNJ6_MOUSE G protein-activated inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj6 PE=1 SV=1
4	P48543	0.0	553	393	0.636	0.684	KCNJ9_MOUSE G protein-activated inward rectifier potassium channel 3 OS=Mus musculus OX=10090 GN=Kcnj9 PE=1 SV=2
5	P48544	0.0	618	419	0.723	0.730	KCNJ5_HUMAN G protein-activated inward rectifier potassium channel 4 OS=Homo sapiens OX=9606 GN=KCNJ5 PE=1 SV=2
6	P48548	0.0	608	419	0.686	0.692	KCNJ5_RAT G protein-activated inward rectifier potassium channel 4 OS=Rattus norvegicus OX=10116 GN=Kcnj5 PE=1 SV=2
7	P48550	0.0	870	425	0.988	0.984	KCNJ6_RAT G protein-activated inward rectifier potassium channel 2 OS=Rattus norvegicus OX=10116 GN=Kcnj6 PE=1 SV=1
8	Q63511	0.0	553	393	0.636	0.684	KCNJ9_RAT G protein-activated inward rectifier potassium channel 3 OS=Rattus norvegicus OX=10116 GN=Kcnj9 PE=1 SV=2
9	Q92806	0.0	554	393	0.634	0.682	KCNJ9_HUMAN G protein-activated inward rectifier potassium channel 3 OS=Homo sapiens OX=9606 GN=KCNJ9 PE=1 SV=2
10	E1BNE9	3.95e-163	470	501	0.504	0.425	KCNJ3_BOVIN G protein-activated inward rectifier potassium channel 1 OS=Bos taurus OX=9913 GN=KCNJ3 PE=1 SV=1
11	P48549	5.97e-163	469	501	0.504	0.425	KCNJ3_HUMAN G protein-activated inward rectifier potassium channel 1 OS=Homo sapiens OX=9606 GN=KCNJ3 PE=1 SV=1
12	P63250	1.28e-162	469	501	0.501	0.423	KCNJ3_MOUSE G protein-activated inward rectifier potassium channel 1 OS=Mus musculus OX=10090 GN=Kcnj3 PE=1 SV=1
13	P63251	1.28e-162	469	501	0.501	0.423	KCNJ3_RAT G protein-activated inward rectifier potassium channel 1 OS=Rattus norvegicus OX=10116 GN=Kcnj3 PE=1 SV=1
14	A0A0R4ICH9	2.63e-139	407	437	0.466	0.451	A0A0R4ICH9_DANRE ATP-sensitive inward rectifier potassium channel 12-like OS=Danio rerio OX=7955 GN=kcnj12a PE=3 SV=1
15	F1NHE9	5.13e-137	401	429	0.442	0.436	KCJ12_CHICK ATP-sensitive inward rectifier potassium channel 12 OS=Gallus gallus OX=9031 GN=KCNJ12 PE=1 SV=1
16	Q14500	9.82e-136	398	433	0.452	0.441	KCJ12_HUMAN ATP-sensitive inward rectifier potassium channel 12 OS=Homo sapiens OX=9606 GN=KCNJ12 PE=1 SV=2
17	P35561	1.69e-135	397	428	0.456	0.451	KCNJ2_MOUSE Inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj2 PE=1 SV=1
18	P52188	2.26e-135	397	427	0.456	0.452	KCJ12_RAT ATP-sensitive inward rectifier potassium channel 12 OS=Rattus norvegicus OX=10116 GN=Kcnj12 PE=1 SV=1
19	P63252	3.94e-135	396	427	0.435	0.431	KCNJ2_HUMAN Inward rectifier potassium channel 2 OS=Homo sapiens OX=9606 GN=KCNJ2 PE=1 SV=1
20	Q64273	1.01e-134	395	427	0.435	0.431	KCNJ2_RAT Inward rectifier potassium channel 2 OS=Rattus norvegicus OX=10116 GN=Kcnj2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07885 Ion_trans_2	7.2e+02	11.5	Ion channel
2	PF01007 IRK	2.7e-56	200.7	Inward rectifier potassium channel transmembrane domain
3	PF17655 IRK_C	5e-68	239.7	Inward rectifier potassium channel C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008567419.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008582086.1	0.950	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
2	482537.XP_008584368.1	0.913	Guanine nucleotide-binding protein subunit beta-5
3	482537.XP_008569833.1	0.910	cAMP-dependent protein kinase catalytic subunit beta isoform X1
4	482537.XP_008563039.1	0.898	Gamma-aminobutyric acid type B receptor subunit 1-like
5	482537.XP_008587090.1	0.898	Gamma-aminobutyric acid type B receptor subunit 1 isoform X1
6	482537.XP_008571559.1	0.873	Guanine nucleotide-binding protein G(o) subunit alpha isoform X1
7	482537.XP_008566332.1	0.871	Guanine nucleotide-binding protein subunit beta-4
8	482537.XP_008578938.1	0.871	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 mRNAs, 34 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008565902.1	0.869	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 35 Proteins, and 30% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008563462.1	0.865	Gamma-aminobutyric acid type B receptor subunit 2-like
11	482537.XP_008573404.1	0.865	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 12 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
12	482537.XP_008563844.1	0.861	Gamma-aminobutyric acid type B receptor subunit 1-like
13	482537.XP_008571717.1	0.854	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
14	482537.XP_008568799.1	0.851	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
15	482537.XP_008569830.1	0.847	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 8 Proteins, and 75% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
16	482537.XP_008569850.1	0.847	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008574112.1	0.847	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 isoform X1
18	482537.XP_008564241.1	0.842	cAMP-dependent protein kinase catalytic subunit alpha isoform X1
19	482537.XP_008564718.1	0.842	G protein-activated inward rectifier potassium channel 4 isoform X1
20	482537.XP_008574981.1	0.840	Guanine nucleotide-binding protein G(i) subunit alpha-2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005242	1.000	inward rectifier potassium channel activity
GO:0005515	0.999	protein binding
GO:0001965	0.682	G-protein alpha-subunit binding
GO:0099508	0.302	voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0006810	0.967	transport
GO:0050794	0.966	regulation of cellular process
GO:0006811	0.960	monoatomic ion transport
GO:0009987	0.954	cellular process
GO:0006812	0.953	monoatomic cation transport
GO:0050896	0.939	response to stimulus
GO:0030001	0.933	metal ion transport
GO:0006813	0.910	potassium ion transport
GO:0065008	0.803	regulation of biological quality
GO:0042221	0.759	response to chemical
GO:0051716	0.699	cellular response to stimulus
GO:0010646	0.632	regulation of cell communication
GO:0090087	0.621	regulation of peptide transport
GO:0023051	0.488	regulation of signaling
GO:0032501	0.474	multicellular organismal process
GO:0010033	0.427	response to organic substance
GO:0070201	0.427	regulation of establishment of protein localization
GO:0048523	0.415	negative regulation of cellular process
GO:0046883	0.402	regulation of hormone secretion
GO:0007154	0.356	cell communication
GO:0048518	0.320	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.761	intracellular anatomical structure
GO:0005737	0.728	cytoplasm
GO:0043231	0.724	intracellular membrane-bounded organelle
GO:0098797	0.411	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]