StarFunc result for job id P48058

User Input

>input (902 residues)
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4u1xC	0.418	0.496	0.000	755	0.622	0.743	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
2	PDB:5idfB	0.558	0.669	0.000	734	0.619	0.760	5idfB.pdb.gz
3	PDB:5kbtA	0.451	0.427	0.000	973	0.653	0.605	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
4	PDB:5weoA	0.476	0.444	0.000	988	0.667	0.609	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
5	PDB:7rz4A	0.446	0.416	0.000	993	0.670	0.608	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
6	PDB:7rzaA	0.448	0.423	0.000	981	0.671	0.617	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
7	AFDB:A0A0R4ING5	0.578	0.578	0.000	903	0.705	0.704	A0A0R4ING5.pdb.gz
8	AFDB:B3DGZ2	0.554	0.555	0.000	898	0.890	0.894	B3DGZ2.pdb.gz
9	AFDB:P19490	0.608	0.605	0.000	907	0.657	0.654	P19490.pdb.gz	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
10	AFDB:P19491	0.569	0.580	0.000	883	0.690	0.704	P19491.pdb.gz	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
11	AFDB:P19493	0.978	0.978	0.000	902	0.982	0.982	P19493.pdb.gz	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
12	AFDB:P42263	0.798	0.805	0.000	894	0.706	0.713	P42263.pdb.gz	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
13	PDB:7ocaA	0.400	0.463	8.459E-104	775	0.630	0.733	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
14	PDB:4u1wA	0.408	0.497	1.444E-102	731	0.614	0.758	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
15	PDB:4uq6B	0.411	0.582	1.838E-91	632	0.494	0.706	4uq6B.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
16	AFDB:Q03445	0.478	0.439	5.908E-86	991	0.408	0.371	Q03445.pdb.gz	GLR1_DROME Glutamate receptor 1 OS=Drosophila melanogaster OX=7227 GN=GluRIA PE=1 SV=2
17	AFDB:Q9VDH5	0.481	0.507	1.443E-83	853	0.366	0.387	Q9VDH5.pdb.gz	Q9VDH5_DROME Kainate-type ionotropic glutamate receptor subunit 1D OS=Drosophila melanogaster OX=7227 GN=KaiR1D PE=1 SV=1
18	AFDB:E7ENK3	0.493	0.469	1.040E-82	949	0.378	0.359	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
19	AFDB:B1AS29	0.441	0.433	2.719E-82	919	0.374	0.367	B1AS29.pdb.gz	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
20	PDB:7vm2B	0.370	0.448	2.853E-63	736	0.330	0.405	7vm2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B1AS29	605	919	0.375	0.368	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
2	E7ENK3	597	949	0.378	0.359	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
3	E9PD61	594	920	0.374	0.366	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	F7AGW3	597	949	0.378	0.359	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
5	H7BYG7	594	871	0.374	0.387	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
6	P19490	1256	907	0.672	0.668	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
7	P19491	1334	883	0.695	0.710	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
8	P19492	1356	888	0.704	0.715	GRIA3_RAT Glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Gria3 PE=1 SV=1
9	P19493	1839	902	0.982	0.982	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
10	P22756	588	949	0.378	0.359	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
11	P23818	1265	907	0.676	0.673	GRIA1_MOUSE Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1
12	P23819	1335	883	0.695	0.710	GRIA2_MOUSE Glutamate receptor 2 OS=Mus musculus OX=10090 GN=Gria2 PE=1 SV=3
13	P39086	595	918	0.385	0.378	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
14	P39087	609	908	0.385	0.382	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
15	P42260	609	908	0.385	0.382	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
16	P42261	1259	906	0.673	0.670	GRIA1_HUMAN Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2
17	P42262	1337	883	0.696	0.711	GRIA2_HUMAN Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GRIA2 PE=1 SV=3
18	P42263	1364	894	0.708	0.715	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
19	P42264	603	919	0.374	0.367	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
20	P48058	1875	902	1.000	1.000	GRIA4_HUMAN Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GRIA4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	4.6e-60	215.3	Receptor family ligand binding region
2	PF09834 DUF2061	2.4e+02	13.7	Predicted membrane protein (DUF2061)
3	PF00060 Lig_chan	2.4e-56	201.2	Ligand-gated ion channel
4	PF10613 Lig_chan-Glu_bd	1.8e-41	152.2	Ligated ion channel L-glutamate- and glycine-binding site
5	PF13458 Peripla_BP_6	56	14.9	Periplasmic binding protein
6	PF00497 SBP_bac_3	1.3e-20	85.4	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300105	0.988	Voltage-dependent calcium channel gamma-2 subunit
2	9606.ENSP00000385205	0.981	PRKCA-binding protein
3	9606.ENSP00000382428	0.978	Disks large homolog 4
4	9606.ENSP00000337168	0.974	Band 4.1-like protein 1
5	9606.ENSP00000381098	0.970	Glutamate receptor-interacting protein 1
6	9606.ENSP00000263431	0.965	Protein kinase C gamma type
7	9606.ENSP00000381412	0.964	Calcium/calmodulin-dependent protein kinase type II subunit alpha
8	9606.ENSP00000365272	0.961	Disks large homolog 2
9	9606.ENSP00000262138	0.958	Voltage-dependent calcium channel gamma-4 subunit
10	9606.ENSP00000296526	0.958	Glutamate receptor 2
11	9606.ENSP00000270458	0.957	Voltage-dependent calcium channel gamma-8 subunit
12	9606.ENSP00000345731	0.957	Disks large homolog 1
13	9606.ENSP00000480660	0.954	Glutamate receptor-interacting protein 2
14	9606.ENSP00000363480	0.953	Disks large homolog 3
15	9606.ENSP00000379098	0.946	Calcium/calmodulin-dependent protein kinase type II subunit beta
16	9606.ENSP00000408695	0.946	Protein kinase C alpha type
17	9606.ENSP00000005284	0.939	Voltage-dependent calcium channel gamma-3 subunit
18	9606.ENSP00000319060	0.936	Calcium/calmodulin-dependent protein kinase type II subunit gamma
19	9606.ENSP00000339740	0.930	Calcium/calmodulin-dependent protein kinase type II subunit delta
20	9606.ENSP00000482169	0.927	Neurofilament light polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022890	0.999	inorganic cation transmembrane transporter activity
GO:0004970	0.999	ionotropic glutamate receptor activity
GO:0008324	0.931	monoatomic cation transmembrane transporter activity
GO:0042802	0.911	identical protein binding
GO:0005261	0.902	monoatomic cation channel activity
GO:0098960	0.901	postsynaptic neurotransmitter receptor activity
GO:0099529	0.892	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.883	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0099507	0.870	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:1901702	0.865	salt transmembrane transporter activity
GO:0046873	0.845	metal ion transmembrane transporter activity
GO:0099094	0.802	ligand-gated monoatomic cation channel activity
GO:0005272	0.802	sodium channel activity
GO:0030165	0.773	PDZ domain binding
GO:0033218	0.757	amide binding
GO:0004971	0.691	AMPA glutamate receptor activity
GO:0005267	0.412	potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0007154	0.974	cell communication
GO:0023052	0.972	signaling
GO:0050896	0.960	response to stimulus
GO:0051716	0.933	cellular response to stimulus
GO:0007267	0.911	cell-cell signaling
GO:0007215	0.909	glutamate receptor signaling pathway
GO:0099537	0.735	trans-synaptic signaling
GO:0032501	0.543	multicellular organismal process
GO:0007268	0.535	chemical synaptic transmission
GO:0023051	0.494	regulation of signaling
GO:0048518	0.452	positive regulation of biological process
GO:0051179	0.363	localization
GO:0048522	0.356	positive regulation of cellular process
GO:0042221	0.353	response to chemical
GO:0065008	0.324	regulation of biological quality
GO:0010646	0.324	regulation of cell communication
GO:0051234	0.321	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.998	organelle
GO:0030054	0.997	cell junction
GO:0043227	0.992	membrane-bounded organelle
GO:0045202	0.991	synapse
GO:0032991	0.989	protein-containing complex
GO:0043005	0.985	neuron projection
GO:0005622	0.982	intracellular anatomical structure
GO:0098797	0.977	plasma membrane protein complex
GO:0030425	0.977	dendrite
GO:0098590	0.965	plasma membrane region
GO:0098794	0.960	postsynapse
GO:0044297	0.958	cell body
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005737	0.954	cytoplasm
GO:0012505	0.935	endomembrane system
GO:0043235	0.932	receptor complex
GO:0043025	0.927	neuronal cell body
GO:0034702	0.926	ion channel complex
GO:0097060	0.923	synaptic membrane
GO:0098802	0.897	plasma membrane signaling receptor complex
GO:0008328	0.889	ionotropic glutamate receptor complex
GO:0099572	0.874	postsynaptic specialization
GO:0031090	0.855	organelle membrane
GO:0005576	0.830	extracellular region
GO:0098984	0.819	neuron to neuron synapse
GO:0031982	0.794	vesicle
GO:0032281	0.792	AMPA glutamate receptor complex
GO:0032279	0.770	asymmetric synapse
GO:0097708	0.648	intracellular vesicle
GO:0031410	0.641	cytoplasmic vesicle
GO:0098588	0.597	bounding membrane of organelle
GO:0098978	0.563	glutamatergic synapse
GO:0030139	0.460	endocytic vesicle
GO:0045211	0.454	postsynaptic membrane
GO:0030666	0.427	endocytic vesicle membrane
GO:0098793	0.411	presynapse
GO:0005783	0.411	endoplasmic reticulum
GO:0014069	0.382	postsynaptic density
GO:0043197	0.364	dendritic spine
GO:0005634	0.343	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.802	Na(+)(in) = Na(+)(out)
RHEA:29463	0.412	K(+)(in) = K(+)(out)

[back to server]