StarFunc result for job id P48061

User Input

>input (93 residues)
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48061	1.000	1.000	4.207E-16	93	1.000	1.000	P48061.pdb.gz	SDF1_HUMAN Stromal cell-derived factor 1 OS=Homo sapiens OX=9606 GN=CXCL12 PE=1 SV=1
2	AFDB:Q80YV8	0.711	0.560	1.022E-13	119	0.882	0.689	Q80YV8.pdb.gz	Q80YV8_RAT Stromal cell-derived factor 1 OS=Rattus norvegicus OX=10116 GN=Cxcl12 PE=1 SV=1
3	AFDB:Q8UUJ9	0.709	0.704	7.885E-13	94	0.645	0.638	Q8UUJ9.pdb.gz	SDF1_XENLA Stromal cell-derived factor 1 OS=Xenopus laevis OX=8355 GN=cxcl12 PE=2 SV=1
4	AFDB:Q6T7B9	0.681	0.489	1.157E-12	131	0.699	0.496	Q6T7B9.pdb.gz	Q6T7B9_CHICK Stromal cell-derived factor 1 OS=Gallus gallus OX=9031 GN=CXCL12 PE=1 SV=1
5	PDB:2n55A	0.587	0.753	2.933E-10	70	0.699	0.929	2n55A.pdb.gz
6	AFDB:Q8AV10	0.643	0.607	7.775E-9	99	0.462	0.434	Q8AV10.pdb.gz	Q8AV10_DANRE Stromal cell-derived factor 1 OS=Danio rerio OX=7955 GN=wu:fa55e10 PE=2 SV=1
7	AFDB:Q6V9B5	0.664	0.639	1.216E-8	97	0.462	0.443	Q6V9B5.pdb.gz	Q6V9B5_DANRE Stromal cell-derived factor 1 (Fragment) OS=Danio rerio OX=7955 GN=SDF1b PE=2 SV=1
8	PDB:7sk6B	0.456	0.671	1.633E-7	59	0.581	0.915	7sk6B.pdb.gz
9	AFDB:A0A0G2KYH9	0.627	0.604	2.286E-6	98	0.258	0.245	A0A0G2KYH9.pdb.gz	A0A0G2KYH9_DANRE Chemokine (C-X-C motif) ligand 8a OS=Danio rerio OX=7955 GN=cxcl8a PE=3 SV=1
10	AFDB:A3DTN6	0.606	0.560	2.769E-6	103	0.323	0.291	A3DTN6.pdb.gz	A3DTN6_CHICK Multifunctional fusion protein OS=Gallus gallus OX=9031 GN=IL8 PE=2 SV=2
11	AFDB:P10889	0.617	0.582	3.354E-6	100	0.290	0.270	P10889.pdb.gz	CXCL2_MOUSE C-X-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Cxcl2 PE=1 SV=2
12	AFDB:P30348	0.568	0.534	4.920E-6	100	0.290	0.270	P30348.pdb.gz	CXCL2_RAT C-X-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Cxcl2 PE=1 SV=1
13	PDB:2mgsA	0.502	0.633	3.952E-4	71	0.183	0.239	2mgsA.pdb.gz
14	PDB:1qe6D	0.485	0.596	4.213E-4	72	0.226	0.292	1qe6D.pdb.gz
15	PDB:1f9rA	0.508	0.692	7.979E-4	65	0.183	0.262	1f9rA.pdb.gz
16	PDB:1f9pA	0.515	0.580	9.066E-4	81	0.183	0.210	1f9pA.pdb.gz
17	PDB:1mgsA	0.513	0.623	9.066E-4	73	0.194	0.247	1mgsA.pdb.gz
18	PDB:1o80A	0.533	0.642	1.098E-3	74	0.204	0.257	1o80A.pdb.gz
19	PDB:5yamA	0.445	0.564	1.830E-3	69	0.215	0.290	5yamA.pdb.gz
20	PDB:1mi2A	0.464	0.562	3.051E-3	73	0.226	0.288	1mi2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48061	1.08e-63	189	93	1.000	1.000	SDF1_HUMAN Stromal cell-derived factor 1 OS=Homo sapiens OX=9606 GN=CXCL12 PE=1 SV=1
2	P40224	8.84e-53	161	93	0.925	0.925	SDF1_MOUSE Stromal cell-derived factor 1 OS=Mus musculus OX=10090 GN=Cxcl12 PE=2 SV=2
3	Q9QZD1	1.68e-49	153	89	0.882	0.921	Q9QZD1_RAT Stromal cell-derived factor 1 OS=Rattus norvegicus OX=10116 GN=Cxcl12 PE=2 SV=1
4	Q80YV8	3.18e-49	153	119	0.882	0.689	Q80YV8_RAT Stromal cell-derived factor 1 OS=Rattus norvegicus OX=10116 GN=Cxcl12 PE=1 SV=1
5	A0A8I6GDX4	1.27e-45	143	81	0.720	0.827	A0A8I6GDX4_RAT Stromal cell-derived factor 1 OS=Rattus norvegicus OX=10116 GN=Cxcl12 PE=1 SV=1
6	Q8UUJ9	1.98e-43	137	94	0.645	0.638	SDF1_XENLA Stromal cell-derived factor 1 OS=Xenopus laevis OX=8355 GN=cxcl12 PE=2 SV=1
7	Q6T7C0	1.12e-42	135	89	0.667	0.697	Q6T7C0_CHICK Stromal cell-derived factor 1 OS=Gallus gallus OX=9031 GN=SDF1 PE=2 SV=1
8	Q6T7B9	5.80e-42	135	131	0.667	0.473	Q6T7B9_CHICK Stromal cell-derived factor 1 OS=Gallus gallus OX=9031 GN=CXCL12 PE=1 SV=1
9	E2IFI5	2.33e-40	129	68	0.634	0.868	E2IFI5_CHICK Stromal cell derived factor-1 (Fragment) OS=Gallus gallus OX=9031 GN=SDF-1 PE=2 SV=1
10	Q6V9B5	6.99e-23	86.3	97	0.452	0.433	Q6V9B5_DANRE Stromal cell-derived factor 1 (Fragment) OS=Danio rerio OX=7955 GN=SDF1b PE=2 SV=1
11	Q8AV10	1.15e-22	85.5	99	0.452	0.424	Q8AV10_DANRE Stromal cell-derived factor 1 OS=Danio rerio OX=7955 GN=wu:fa55e10 PE=2 SV=1
12	A0A0G2KYH9	4.21e-06	43.5	98	0.269	0.255	A0A0G2KYH9_DANRE Chemokine (C-X-C motif) ligand 8a OS=Danio rerio OX=7955 GN=cxcl8a PE=3 SV=1
13	P17515	5.62e-06	43.1	98	0.290	0.276	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
14	P50231	1.19e-05	42.0	92	0.301	0.304	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
15	P30882	1.22e-05	42.0	91	0.312	0.319	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
16	P12850	1.72e-05	41.6	96	0.237	0.229	GROA_MOUSE Growth-regulated alpha protein OS=Mus musculus OX=10090 GN=Cxcl1 PE=1 SV=1
17	P14095	3.33e-05	40.8	96	0.237	0.229	GROA_RAT Growth-regulated alpha protein OS=Rattus norvegicus OX=10116 GN=Cxcl1 PE=1 SV=2
18	Q9JKC0	4.37e-04	38.5	119	0.226	0.176	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
19	P10145	6.06e-04	37.7	99	0.269	0.253	IL8_HUMAN Interleukin-8 OS=Homo sapiens OX=9606 GN=CXCL8 PE=1 SV=1
20	P50229	7.39e-04	37.4	92	0.226	0.228	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	1.1e-05	36.9	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000023232

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010812	0.981	C-X-C motif chemokine receptor 4
2	61853.ENSNLEP00000012996	0.971	Atypical chemokine receptor 3
3	61853.ENSNLEP00000001309	0.933	Chemokine (C-X-C motif) receptor 3
4	61853.ENSNLEP00000008993	0.933	Chemokine (C-X-C motif) receptor 5
5	61853.ENSNLEP00000007411	0.917	Chemokine (C-C motif) receptor 1
6	61853.ENSNLEP00000024144	0.917	Chemokine (C-C motif) receptor 7
7	61853.ENSNLEP00000010251	0.897	Chemokine (C-X-C motif) receptor 2
8	61853.ENSNLEP00000008890	0.878	Chemokine (C-X-C motif) receptor 1
9	61853.ENSNLEP00000016023	0.878	Chemokine (C-C motif) receptor 2
10	61853.ENSNLEP00000007418	0.876	Chemokine (C-C motif) receptor 3
11	61853.ENSNLEP00000014147	0.875	Belongs to the G-protein coupled receptor 1 family.
12	61853.ENSNLEP00000007377	0.872	Chemokine (C-C motif) receptor 9
13	61853.ENSNLEP00000006785	0.842	Chemokine (C-X3-C motif) receptor 1
14	61853.ENSNLEP00000022426	0.819	Chemokine (C-C motif) receptor 8
15	61853.ENSNLEP00000022424	0.816	Chemokine (C-C motif) receptor 4
16	61853.ENSNLEP00000005807	0.795	Chemokine (C-C motif) ligand 19
17	61853.ENSNLEP00000007406	0.782	Chemokine (C motif) receptor 1
18	61853.ENSNLEP00000005795	0.778	Chemokine (C-C motif) ligand 21
19	61853.ENSNLEP00000009974	0.762	Chemokine (C-X-C motif) ligand 13
20	61853.ENSNLEP00000017204	0.759	Chemokine (C-C motif) ligand 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0030335	0.987	positive regulation of cell migration
GO:0051049	0.986	regulation of transport
GO:0050793	0.984	regulation of developmental process
GO:0051924	0.983	regulation of calcium ion transport
GO:0042221	0.978	response to chemical
GO:0016477	0.976	cell migration
GO:0050921	0.976	positive regulation of chemotaxis
GO:0051094	0.970	positive regulation of developmental process
GO:0051050	0.966	positive regulation of transport
GO:0007154	0.963	cell communication
GO:0048856	0.956	anatomical structure development
GO:0010033	0.955	response to organic substance
GO:0002376	0.952	immune system process
GO:0006950	0.951	response to stress
GO:0009605	0.950	response to external stimulus
GO:0032501	0.946	multicellular organismal process
GO:0051128	0.944	regulation of cellular component organization
GO:0007275	0.941	multicellular organism development
GO:0006935	0.940	chemotaxis
GO:0065008	0.934	regulation of biological quality
GO:1990869	0.920	cellular response to chemokine
GO:0071840	0.885	cellular component organization or biogenesis
GO:0023051	0.869	regulation of signaling
GO:0010646	0.869	regulation of cell communication
GO:0045597	0.864	positive regulation of cell differentiation
GO:0002685	0.848	regulation of leukocyte migration
GO:0008284	0.844	positive regulation of cell population proliferation
GO:0050678	0.832	regulation of epithelial cell proliferation
GO:0016043	0.830	cellular component organization
GO:0051130	0.823	positive regulation of cellular component organization
GO:0007165	0.797	signal transduction
GO:0050900	0.793	leukocyte migration
GO:0006955	0.774	immune response
GO:0050679	0.765	positive regulation of epithelial cell proliferation
GO:0002684	0.762	positive regulation of immune system process
GO:0044419	0.756	biological process involved in interspecies interaction between organisms
GO:0048731	0.756	system development
GO:0006959	0.746	humoral immune response
GO:0007166	0.744	cell surface receptor signaling pathway
GO:0002687	0.743	positive regulation of leukocyte migration
GO:0030154	0.740	cell differentiation
GO:0001936	0.737	regulation of endothelial cell proliferation
GO:0051240	0.725	positive regulation of multicellular organismal process
GO:0009966	0.720	regulation of signal transduction
GO:0030307	0.718	positive regulation of cell growth
GO:0048523	0.717	negative regulation of cellular process
GO:0048513	0.716	animal organ development
GO:0048699	0.690	generation of neurons
GO:1902531	0.686	regulation of intracellular signal transduction
GO:0043067	0.646	regulation of programmed cell death
GO:1901861	0.645	regulation of muscle tissue development
GO:0021537	0.634	telencephalon development
GO:0042981	0.625	regulation of apoptotic process
GO:0065009	0.618	regulation of molecular function
GO:0022029	0.612	telencephalon cell migration
GO:0006952	0.587	defense response
GO:0019221	0.565	cytokine-mediated signaling pathway
GO:2000401	0.562	regulation of lymphocyte migration
GO:0060326	0.556	cell chemotaxis
GO:0050877	0.551	nervous system process
GO:0043207	0.546	response to external biotic stimulus
GO:0051928	0.538	positive regulation of calcium ion transport
GO:0051707	0.534	response to other organism
GO:0023056	0.529	positive regulation of signaling
GO:0010647	0.521	positive regulation of cell communication
GO:0007600	0.516	sensory perception
GO:0090066	0.497	regulation of anatomical structure size
GO:0006954	0.483	inflammatory response
GO:0007186	0.479	G protein-coupled receptor signaling pathway
GO:0042592	0.456	homeostatic process
GO:0030595	0.454	leukocyte chemotaxis
GO:0032535	0.452	regulation of cellular component size
GO:0071677	0.450	positive regulation of mononuclear cell migration
GO:2000026	0.438	regulation of multicellular organismal development
GO:0030336	0.433	negative regulation of cell migration
GO:0002688	0.396	regulation of leukocyte chemotaxis
GO:2000403	0.386	positive regulation of lymphocyte migration
GO:0019222	0.373	regulation of metabolic process
GO:0090279	0.373	regulation of calcium ion import
GO:0060284	0.356	regulation of cell development
GO:0030003	0.349	intracellular monoatomic cation homeostasis
GO:0010720	0.331	positive regulation of cell development
GO:0009893	0.329	positive regulation of metabolic process
GO:0051179	0.327	localization
GO:0009967	0.325	positive regulation of signal transduction
GO:0031323	0.314	regulation of cellular metabolic process
GO:0001775	0.307	cell activation
GO:0098771	0.305	inorganic ion homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005615	0.998	extracellular space
GO:0005737	0.996	cytoplasm
GO:0005886	0.992	plasma membrane
GO:0043229	0.988	intracellular organelle
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0005634	0.811	nucleus
GO:0009986	0.632	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]