StarFunc result for job id P48169

User Input

>input (554 residues)
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFG
SRLQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48169	1.000	1.000	7.700E-97	554	1.000	1.000	P48169.pdb.gz	GBRA4_HUMAN Gamma-aminobutyric acid receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=GABRA4 PE=1 SV=2
2	AFDB:P28471	0.794	0.796	4.586E-86	552	0.894	0.897	P28471.pdb.gz	GBRA4_RAT Gamma-aminobutyric acid receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Gabra4 PE=1 SV=1
3	AFDB:P16305	0.682	0.828	6.813E-64	453	0.574	0.702	P16305.pdb.gz	GBRA6_MOUSE Gamma-aminobutyric acid receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Gabra6 PE=1 SV=3
4	AFDB:P20236	0.636	0.713	2.054E-59	493	0.498	0.560	P20236.pdb.gz	GBRA3_RAT Gamma-aminobutyric acid receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gabra3 PE=1 SV=2
5	AFDB:P14867	0.609	0.737	6.768E-58	456	0.498	0.605	P14867.pdb.gz	GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GABRA1 PE=1 SV=3
6	AFDB:P23576	0.595	0.729	4.234E-57	451	0.477	0.585	P23576.pdb.gz	GBRA2_RAT Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1
7	AFDB:Q08BJ3	0.633	0.760	5.639E-57	459	0.480	0.580	Q08BJ3.pdb.gz	Q08BJ3_DANRE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Danio rerio OX=7955 GN=zgc:153566 PE=1 SV=1
8	AFDB:P19969	0.610	0.728	1.258E-56	464	0.468	0.558	P19969.pdb.gz	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
9	PDB:6i53A	0.530	0.838	1.417E-49	349	0.406	0.645	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
10	AFDB:F1RDP2	0.606	0.702	1.452E-48	477	0.394	0.457	F1RDP2.pdb.gz	F1RDP2_DANRE Gamma-aminobutyric acid receptor subunit gamma-2 isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-145n14.1 PE=3 SV=3
11	AFDB:P22723	0.610	0.711	9.086E-48	474	0.375	0.439	P22723.pdb.gz	GBRG2_MOUSE Gamma-aminobutyric acid receptor subunit gamma-2 OS=Mus musculus OX=10090 GN=Gabrg2 PE=1 SV=3
12	PDB:6i53B	0.524	0.853	2.914E-36	338	0.229	0.376	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.481	0.770	1.200E-28	338	0.186	0.305	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.464	0.804	9.824E-21	311	0.088	0.158	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.410	0.704	2.993E-17	311	0.092	0.164	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:4aq5E	0.450	0.652	1.362E-13	370	0.097	0.146	4aq5E.pdb.gz
17	PDB:2w8gC	0.328	0.793	2.034E-13	217	0.074	0.189	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
18	PDB:4afhA	0.308	0.749	8.519E-13	213	0.065	0.169	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:6zgdA	0.409	0.751	3.779E-12	288	0.079	0.153	6zgdA.pdb.gz
20	PDB:7nupD	0.095	0.071	6.518E-4	884	0.032	0.020	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16305	0.0	602	453	0.514	0.629	GBRA6_MOUSE Gamma-aminobutyric acid receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Gabra6 PE=1 SV=3
2	P28471	0.0	953	552	0.894	0.897	GBRA4_RAT Gamma-aminobutyric acid receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Gabra4 PE=1 SV=1
3	P30191	0.0	595	453	0.505	0.618	GBRA6_RAT Gamma-aminobutyric acid receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Gabra6 PE=1 SV=1
4	P48169	0.0	1150	554	1.000	1.000	GBRA4_HUMAN Gamma-aminobutyric acid receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=GABRA4 PE=1 SV=2
5	Q16445	0.0	602	453	0.516	0.631	GBRA6_HUMAN Gamma-aminobutyric acid receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=GABRA6 PE=2 SV=2
6	Q9D6F4	0.0	986	552	0.904	0.908	GBRA4_MOUSE Gamma-aminobutyric acid receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Gabra4 PE=2 SV=1
7	P20236	3.22e-174	503	493	0.439	0.493	GBRA3_RAT Gamma-aminobutyric acid receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Gabra3 PE=1 SV=2
8	P34903	2.80e-173	501	492	0.435	0.490	GBRA3_HUMAN Gamma-aminobutyric acid receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GABRA3 PE=1 SV=1
9	P26049	7.00e-173	499	492	0.440	0.496	GBRA3_MOUSE Gamma-aminobutyric acid receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Gabra3 PE=1 SV=1
10	Q08BJ3	7.06e-169	488	459	0.424	0.512	Q08BJ3_DANRE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Danio rerio OX=7955 GN=zgc:153566 PE=1 SV=1
11	P62812	3.18e-168	486	455	0.431	0.525	GBRA1_MOUSE Gamma-aminobutyric acid receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Gabra1 PE=1 SV=1
12	P62813	3.18e-168	486	455	0.431	0.525	GBRA1_RAT Gamma-aminobutyric acid receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gabra1 PE=1 SV=1
13	P14867	8.59e-168	485	456	0.431	0.524	GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GABRA1 PE=1 SV=3
14	P31644	6.93e-165	478	462	0.417	0.500	GBRA5_HUMAN Gamma-aminobutyric acid receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=GABRA5 PE=1 SV=1
15	Q8BHJ7	9.62e-165	478	463	0.403	0.482	GBRA5_MOUSE Gamma-aminobutyric acid receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Gabra5 PE=1 SV=1
16	P19969	1.35e-164	478	464	0.403	0.481	GBRA5_RAT Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1
17	P23576	5.74e-164	475	451	0.412	0.506	GBRA2_RAT Gamma-aminobutyric acid receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gabra2 PE=1 SV=1
18	P47869	7.21e-164	475	451	0.410	0.503	GBRA2_HUMAN Gamma-aminobutyric acid receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GABRA2 PE=1 SV=2
19	P26048	7.70e-164	475	451	0.406	0.499	GBRA2_MOUSE Gamma-aminobutyric acid receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Gabra2 PE=1 SV=1
20	A0A2R8Q1Q9	8.06e-126	379	469	0.329	0.388	A0A2R8Q1Q9_DANRE Gamma-aminobutyric acid receptor subunit gamma-2 isoform X2 OS=Danio rerio OX=7955 GN=si:ch211-145n14.1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14342 DUF4396	7.4e+02	11.9	Domain of unknown function (DUF4396)
2	PF02931 Neur_chan_LBD	3.6e-46	168.9	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	1.1e-42	158.3	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264318

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393097	0.942	Gamma-aminobutyric acid receptor subunit alpha-1
2	9606.ENSP00000417901	0.942	Gephyrin
3	9606.ENSP00000306866	0.935	Gamma-aminobutyric acid receptor-associated protein
4	9606.ENSP00000274545	0.930	Gamma-aminobutyric acid receptor subunit alpha-6
5	9606.ENSP00000335592	0.925	Gamma-aminobutyric acid receptor subunit alpha-5
6	9606.ENSP00000381293	0.918	Vesicle-fusing ATPase
7	9606.ENSP00000421828	0.916	Gamma-aminobutyric acid receptor subunit alpha-2
8	9606.ENSP00000362014	0.914	Dynamin-1
9	9606.ENSP00000359337	0.909	Gamma-aminobutyric acid receptor subunit alpha-3
10	9606.ENSP00000365576	0.906	Ubiquilin-1
11	9606.ENSP00000259455	0.813	Gamma-aminobutyric acid type B receptor subunit 2
12	9606.ENSP00000274547	0.793	Gamma-aminobutyric acid receptor subunit beta-2
13	9606.ENSP00000410732	0.772	Gamma-aminobutyric acid receptor subunit gamma-2
14	9606.ENSP00000295454	0.765	Gamma-aminobutyric acid receptor subunit beta-1
15	9606.ENSP00000295452	0.737	Gamma-aminobutyric acid receptor subunit gamma-1
16	9606.ENSP00000308725	0.724	Gamma-aminobutyric acid receptor subunit beta-3
17	9606.ENSP00000367848	0.691	Gamma-aminobutyric acid receptor subunit delta
18	9606.ENSP00000469332	0.668	Gamma-aminobutyric acid receptor subunit theta
19	9606.ENSP00000266458	0.648	Gamma-aminobutyric acid receptor-associated protein-like 1
20	9606.ENSP00000479113	0.645	Gamma-aminobutyric acid receptor subunit gamma-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0022824	1.000	transmitter-gated monoatomic ion channel activity
GO:0015318	0.990	inorganic molecular entity transmembrane transporter activity
GO:0005254	0.976	chloride channel activity
GO:0016917	0.947	GABA receptor activity
GO:0005488	0.944	binding
GO:0098960	0.941	postsynaptic neurotransmitter receptor activity
GO:0005515	0.825	protein binding
GO:0099529	0.633	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.609	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0004890	0.579	GABA-A receptor activity
GO:0008324	0.354	monoatomic cation transmembrane transporter activity
GO:0099095	0.354	ligand-gated monoatomic anion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007154	0.987	cell communication
GO:0023052	0.980	signaling
GO:0007267	0.950	cell-cell signaling
GO:0065007	0.862	biological regulation
GO:0050789	0.823	regulation of biological process
GO:0050794	0.602	regulation of cellular process
GO:0032501	0.598	multicellular organismal process
GO:0050896	0.569	response to stimulus
GO:0006810	0.471	transport
GO:0032502	0.442	developmental process
GO:0048856	0.377	anatomical structure development
GO:0051716	0.346	cellular response to stimulus
GO:0007165	0.319	signal transduction
GO:0007275	0.306	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.968	protein-containing complex
GO:0043226	0.920	organelle
GO:0030054	0.661	cell junction
GO:0005622	0.650	intracellular anatomical structure
GO:0045202	0.604	synapse
GO:0098590	0.462	plasma membrane region
GO:0043235	0.416	receptor complex
GO:0097060	0.338	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.978	chloride(in) = chloride(out)

[back to server]