StarFunc result for job id P48200

User Input

>input (963 residues)
MDAPKAGYAFEYLIETLNDSSHKKFFDVSKLGTKYDVLPYSIRVLLEAAVRNCDGFLMKK
EDVMNILDWKTKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPEKVHPAC
PTDLTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDS
GELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSRVFK
NVAVIPPGTGMAHQINLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGWGVGGIE
TEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAGKFVEFFGSGV
SQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRN
DQNSSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIA
AEKQKDIVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVKP
YIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSICVGNTAPLSDAVLNAVKQGD
LVTCGILSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDPTGKNIY
LHDIWPSREEVHRVEEEHVILSMFKALKDKIEMGNKRWNSLEAPDSVLFPWDLKSTYIRC
PSFFDKLTKEPIALQAIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKYLTNRGLTPRE
FNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIP
LIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENAD
SLGLSGRETFSLTFPEELSPGITLNIQTSTGKVFSVIASFEDDVEITLYKHGGLLNFVAR
KFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2b3xA	0.871	0.942	0.000	888	0.563	0.610	2b3xA.pdb.gz	Crystal structure of human iron regulatory protein 1 as cytosolic aconitase
2	AFDB:B0RSR5	0.844	0.880	0.000	922	0.430	0.449	B0RSR5.pdb.gz	B0RSR5_XANCB Aconitate hydratase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=rpfA PE=3 SV=1
3	AFDB:O53166	0.852	0.869	0.000	943	0.422	0.431	O53166.pdb.gz	ACNA_MYCTU Aconitate hydratase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acn PE=1 SV=1
4	AFDB:P09339	0.880	0.931	0.000	909	0.422	0.447	P09339.pdb.gz	ACNA_BACSU Aconitate hydratase A OS=Bacillus subtilis (strain 168) OX=224308 GN=citB PE=1 SV=4
5	AFDB:P21399	0.905	0.980	0.000	889	0.563	0.610	P21399.pdb.gz	ACOHC_HUMAN Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3
6	AFDB:P25516	0.850	0.916	0.000	891	0.423	0.457	P25516.pdb.gz	ACNA_ECOLI Aconitate hydratase A OS=Escherichia coli (strain K12) OX=83333 GN=acnA PE=1 SV=3
7	AFDB:P37032	0.847	0.913	0.000	891	0.415	0.449	P37032.pdb.gz	ACON_LEGPH Aconitate hydratase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=acn PE=1 SV=1
8	AFDB:P48200	1.000	1.000	0.000	963	1.000	1.000	P48200.pdb.gz	IREB2_HUMAN Iron-responsive element-binding protein 2 OS=Homo sapiens OX=9606 GN=IREB2 PE=1 SV=4
9	AFDB:P70920	0.863	0.916	0.000	906	0.408	0.434	P70920.pdb.gz	ACNA_BRADU Aconitate hydratase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=acnA PE=2 SV=2
10	AFDB:Q23500	0.862	0.932	0.000	887	0.521	0.566	Q23500.pdb.gz	ACOHC_CAEEL Cytoplasmic aconitate hydratase OS=Caenorhabditis elegans OX=6239 GN=aco-1 PE=1 SV=1
11	AFDB:Q388J9	0.861	0.922	0.000	897	0.464	0.498	Q388J9.pdb.gz	Q388J9_TRYB2 Aconitate hydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2880 PE=3 SV=1
12	PDB:6vcdA	0.619	0.907	1.122E-98	643	0.666	0.997	6vcdA.pdb.gz	FBXL5 Regulates IRP2 Stability in Iron Homeostasis via an Oxygen-Responsive [2Fe2S] Cluster.
13	PDB:1acoA	0.633	0.795	1.514E-49	753	0.197	0.252	1acoA.pdb.gz	Crystal structures of aconitase with trans-aconitate and nitrocitrate bound.
14	PDB:1l5jA	0.362	0.401	9.256E-20	862	0.105	0.117	1l5jA.pdb.gz	E. coli aconitase B structure reveals a HEAT-like domain with implications for protein-protein recognition.
15	PDB:3vbaA	0.130	0.626	1.634E-7	169	0.044	0.249	3vbaA.pdb.gz
16	PDB:2pkpA	0.146	0.739	3.325E-7	167	0.047	0.269	2pkpA.pdb.gz	Substrate specificity determinants of the methanogen homoaconitase enzyme: structure and function of the small subunit
17	PDB:3h5hB	0.113	0.528	1.152E-4	169	0.033	0.189	3h5hB.pdb.gz
18	PDB:4ambB	0.092	0.164	4.483E-3	373	0.048	0.123	4ambB.pdb.gz
19	PDB:4an4D	0.105	0.193	4.735E-3	348	0.057	0.158	4an4D.pdb.gz
20	PDB:3o8lA	0.094	0.106	1.018E-2	748	0.070	0.090	3o8lA.pdb.gz	The Crystal Structures of Eukaryotic Phosphofructokinases from Baker's Yeast and Rabbit Skeletal Muscle.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B0RSR5	731	922	0.383	0.400	B0RSR5_XANCB Aconitate hydratase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=rpfA PE=3 SV=1
2	O53166	692	943	0.372	0.380	ACNA_MYCTU Aconitate hydratase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acn PE=1 SV=1
3	O76934	906	902	0.456	0.487	O76934_DROME Iron regulatory protein-1A OS=Drosophila melanogaster OX=7227 GN=Irp-1A PE=2 SV=1
4	O76935	911	899	0.450	0.482	O76935_DROME Iron regulatory protein-1B OS=Drosophila melanogaster OX=7227 GN=Irp-1B PE=2 SV=1
5	P09339	734	909	0.366	0.387	ACNA_BACSU Aconitate hydratase A OS=Bacillus subtilis (strain 168) OX=224308 GN=citB PE=1 SV=4
6	P21399	1058	889	0.536	0.580	ACOHC_HUMAN Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3
7	P25516	707	891	0.406	0.439	ACNA_ECOLI Aconitate hydratase A OS=Escherichia coli (strain K12) OX=83333 GN=acnA PE=1 SV=3
8	P28271	999	889	0.484	0.524	ACOHC_MOUSE Cytoplasmic aconitate hydratase OS=Mus musculus OX=10090 GN=Aco1 PE=1 SV=3
9	P37032	687	891	0.369	0.398	ACON_LEGPH Aconitate hydratase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=acn PE=1 SV=1
10	P48200	1986	963	1.000	1.000	IREB2_HUMAN Iron-responsive element-binding protein 2 OS=Homo sapiens OX=9606 GN=IREB2 PE=1 SV=4
11	P70920	734	906	0.401	0.426	ACNA_BRADU Aconitate hydratase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=acnA PE=2 SV=2
12	Q0VCU1	995	889	0.482	0.522	ACOHC_BOVIN Cytoplasmic aconitate hydratase OS=Bos taurus OX=9913 GN=ACO1 PE=2 SV=1
13	Q23500	906	887	0.445	0.484	ACOHC_CAEEL Cytoplasmic aconitate hydratase OS=Caenorhabditis elegans OX=6239 GN=aco-1 PE=1 SV=1
14	Q388J9	796	897	0.451	0.484	Q388J9_TRYB2 Aconitate hydratase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2880 PE=3 SV=1
15	Q42560	907	898	0.476	0.510	ACO1_ARATH Aconitate hydratase 1 OS=Arabidopsis thaliana OX=3702 GN=ACO1 PE=1 SV=2
16	Q5SMF6	749	902	0.401	0.428	ACNA_THET8 Aconitate hydratase A OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=acoA PE=3 SV=1
17	Q62751	1876	963	0.938	0.938	IREB2_RAT Iron-responsive element-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ireb2 PE=1 SV=2
18	Q63270	984	889	0.479	0.519	ACOHC_RAT Cytoplasmic aconitate hydratase OS=Rattus norvegicus OX=10116 GN=Aco1 PE=1 SV=1
19	Q811J3	1870	963	0.937	0.937	IREB2_MOUSE Iron-responsive element-binding protein 2 OS=Mus musculus OX=10090 GN=Ireb2 PE=1 SV=2
20	Q8IDR8	721	909	0.374	0.396	Q8IDR8_PLAF7 Aconitate hydratase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1342100 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00330 Aconitase	3e-143	489.8	Aconitase family (aconitate hydratase)
2	PF00694 Aconitase_C	3.1e-27	106.9	Aconitase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344866	0.999	F-box/LRR-repeat protein 5
2	9606.ENSP00000231487	0.988	S-phase kinase-associated protein 1
3	9606.ENSP00000315112	0.947	E3 ubiquitin-protein ligase RNF31
4	9606.ENSP00000357633	0.946	Glutaredoxin-3
5	9606.ENSP00000326804	0.944	Cullin-1
6	9606.ENSP00000250495	0.919	NEDD8
7	9606.ENSP00000304697	0.916	Polyubiquitin-B
8	9606.ENSP00000441543	0.914	Polyubiquitin-C
9	9606.ENSP00000272317	0.906	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000388107	0.903	Ubiquitin-60S ribosomal protein L40
11	9606.ENSP00000348632	0.857	RanBP-type and C3HC4-type zinc finger-containing protein 1
12	9606.ENSP00000378364	0.834	Natural resistance-associated macrophage protein 2
13	9606.ENSP00000353224	0.827	Transferrin receptor protein 1
14	9606.ENSP00000300030	0.765	MIP18 family protein FAM96A
15	9606.ENSP00000363205	0.753	Cysteine desulfurase, mitochondrial
16	9606.ENSP00000373073	0.753	Urocanate hydratase 1
17	9606.ENSP00000261024	0.744	Solute carrier family 40 member 1
18	9606.ENSP00000356988	0.744	Deaminated glutathione amidase
19	9606.ENSP00000273550	0.741	Ferritin heavy chain
20	9606.ENSP00000264954	0.740	GrpE protein homolog 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003994	1.000	aconitate hydratase activity
GO:0003729	1.000	mRNA binding
GO:0005515	0.974	protein binding
GO:0030350	0.827	iron-responsive element binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.933	cellular process
GO:0008152	0.847	metabolic process
GO:0044237	0.773	cellular metabolic process
GO:0071704	0.717	organic substance metabolic process
GO:0006807	0.480	nitrogen compound metabolic process
GO:0050789	0.375	regulation of biological process
GO:0055072	0.345	iron ion homeostasis
GO:1901564	0.341	organonitrogen compound metabolic process
GO:0050794	0.301	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005739	0.940	mitochondrion
GO:0070013	0.487	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10336	1.000	citrate = D-threo-isocitrate
EC:4.2.1.3	1.000	aconitate hydratase.

[back to server]