StarFunc result for job id P48201

User Input

>input (142 residues)
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF
QTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILG
FALSEAMGLFCLMVAFLILFAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48201	1.000	1.000	3.822E-19	142	1.000	1.000	P48201.pdb.gz	AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC3 PE=1 SV=1
2	AFDB:Q06645	0.578	0.603	1.464E-12	136	0.732	0.765	Q06645.pdb.gz	AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1
3	AFDB:P05496	0.602	0.629	2.748E-12	136	0.690	0.721	P05496.pdb.gz	AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC1 PE=1 SV=2
4	AFDB:P07926	0.607	0.603	4.598E-12	143	0.739	0.734	P07926.pdb.gz	AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC2 PE=1 SV=1
5	AFDB:P56383	0.601	0.585	6.480E-12	146	0.732	0.712	P56383.pdb.gz	AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc2 PE=1 SV=2
6	AFDB:Q6NN09	0.552	0.568	2.521E-10	138	0.620	0.638	Q6NN09.pdb.gz	Q6NN09_DROME ATPase protein 9 OS=Drosophila melanogaster OX=7227 GN=ATPsynC PE=1 SV=1
7	AFDB:P00842	0.566	0.547	1.343E-6	147	0.373	0.361	P00842.pdb.gz	ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=oli PE=1 SV=1
8	AFDB:P16000	0.552	0.548	1.787E-6	143	0.401	0.399	P16000.pdb.gz	ATP9_EMENI ATP synthase subunit 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atp9 PE=3 SV=2
9	AFDB:O43937	0.480	0.574	3.760E-6	118	0.331	0.398	O43937.pdb.gz	O43937_TRYBB ATPase subunit 9 homolog OS=Trypanosoma brucei brucei OX=5702 PE=2 SV=1
10	AFDB:Q57WQ3	0.524	0.632	5.005E-6	117	0.338	0.410	Q57WQ3.pdb.gz	Q57WQ3_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.800 PE=3 SV=1
11	PDB:2wpdJ	0.481	0.866	1.188E-4	76	0.317	0.592	2wpdJ.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
12	PDB:8ap9P	0.461	0.826	3.326E-4	78	0.275	0.500	8ap9P.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
13	PDB:3zk1A	0.506	0.781	2.608E-3	89	0.169	0.270	3zk1A.pdb.gz	A New Type of Na(+)-Driven ATP Synthase Membrane Rotor with a Two-Carboxylate Ion-Coupling Motif.
14	PDB:1a91A	0.279	0.442	7.513E-1	79	0.106	0.190	1a91A.pdb.gz
15	PDB:7nsuD	0.372	0.147	1.673	420	0.056	0.019	7nsuD.pdb.gz
16	PDB:6wlw0	0.351	0.256	2.104	204	0.155	0.108	6wlw0.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
17	PDB:4q4aA	0.291	0.097	2.497	572	0.056	0.014	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
18	PDB:7ehlA	0.263	0.090	3.324	563	0.077	0.020	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
19	PDB:2b5uA	0.376	0.135	3.520	470	0.056	0.017	2b5uA.pdb.gz
20	PDB:5ew5A	0.313	0.116	3.520	490	0.056	0.016	5ew5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48201	2.40e-98	280	142	1.000	1.000	AT5G3_HUMAN ATP synthase F(0) complex subunit C3, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC3 PE=1 SV=1
2	Q71S46	2.40e-98	280	142	1.000	1.000	AT5G3_RAT ATP synthase F(0) complex subunit C3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc3 PE=1 SV=1
3	Q3ZC75	1.83e-92	265	141	0.944	0.950	AT5G3_BOVIN ATP synthase F(0) complex subunit C3, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC3 PE=2 SV=1
4	P56384	7.37e-91	261	141	0.951	0.957	AT5G3_MOUSE ATP synthase F(0) complex subunit C3, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc3 PE=1 SV=1
5	Q06055	2.63e-66	199	141	0.746	0.752	AT5G2_HUMAN ATP synthase F(0) complex subunit C2, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC2 PE=1 SV=1
6	Q06646	1.40e-64	195	141	0.739	0.745	AT5G2_RAT ATP synthase F(0) complex subunit C2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc2 PE=1 SV=1
7	P07926	7.50e-64	193	143	0.739	0.734	AT5G2_BOVIN ATP synthase F(0) complex subunit C2, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC2 PE=1 SV=1
8	Q9CR84	9.36e-63	190	136	0.718	0.750	AT5G1_MOUSE ATP synthase F(0) complex subunit C1, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc1 PE=1 SV=1
9	P32876	1.83e-62	189	136	0.718	0.750	AT5G1_BOVIN ATP synthase F(0) complex subunit C1, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MC1 PE=1 SV=1
10	Q06645	3.76e-62	189	136	0.718	0.750	AT5G1_RAT ATP synthase F(0) complex subunit C1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mc1 PE=1 SV=1
11	P56383	1.85e-61	187	146	0.732	0.712	AT5G2_MOUSE ATP synthase F(0) complex subunit C2, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mc2 PE=1 SV=2
12	P05496	3.35e-59	181	136	0.697	0.728	AT5G1_HUMAN ATP synthase F(0) complex subunit C1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MC1 PE=1 SV=2
13	Q6NN09	4.67e-51	160	138	0.627	0.645	Q6NN09_DROME ATPase protein 9 OS=Drosophila melanogaster OX=7227 GN=ATPsynC PE=1 SV=1
14	P61829	8.39e-24	89.7	76	0.317	0.592	ATP9_YEAST ATP synthase subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OLI1 PE=1 SV=1
15	Q38C84	1.35e-22	87.8	118	0.324	0.390	Q38C84_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6340 PE=1 SV=1
16	Q57WQ3	3.94e-22	86.7	117	0.310	0.376	Q57WQ3_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.800 PE=3 SV=1
17	O43937	4.09e-22	86.7	118	0.310	0.373	O43937_TRYBB ATPase subunit 9 homolog OS=Trypanosoma brucei brucei OX=5702 PE=2 SV=1
18	Q385P0	4.09e-22	86.7	118	0.310	0.373	Q385P0_TRYB2 ATPase subunit 9, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2950 PE=3 SV=1
19	P00842	3.05e-21	85.5	147	0.310	0.299	ATP9_NEUCR ATP synthase subunit 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=oli PE=1 SV=1
20	Q37315	6.11e-18	75.1	88	0.254	0.409	ATP9_DICDI ATP synthase subunit 9, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=atp9 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00137 ATP-synt_C	4.5e-07	41.4	ATP synthase subunit C
2	PF07332 Phage_holin_3_6	3.1e+02	12.8	Putative Actinobacterial Holin-X, holin superfamily III
3	PF08973 TM1506	95	14.1	Domain of unknown function (DUF1893)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000023807

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004835	0.999	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
2	61853.ENSNLEP00000005120	0.999	Uncharacterized protein
3	61853.ENSNLEP00000014516	0.999	ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
4	61853.ENSNLEP00000021189	0.999	ATP synthase subunit beta
5	61853.ENSNLEP00000000662	0.998	ATP synthase subunit d, mitochondrial
6	61853.ENSNLEP00000002932	0.998	ATP synthase-coupling factor 6, mitochondrial
7	61853.ENSNLEP00000003299	0.998	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
8	61853.ENSNLEP00000013617	0.998	ATP synthase subunit alpha
9	61853.ENSNLEP00000013500	0.993	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2
10	61853.ENSNLEP00000018512	0.990	Uncharacterized protein
11	61853.ENSNLEP00000001688	0.988	Uncharacterized protein
12	61853.ENSNLEP00000001037	0.984	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E
13	61853.ENSNLEP00000019701	0.964	Chromosome 14 open reading frame 2
14	61853.ENSNLEP00000022999	0.948	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G2
15	61853.ENSNLEP00000008982	0.927	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
16	61853.ENSNLEP00000022535	0.922	Uncharacterized protein
17	61853.ENSNLEP00000017970	0.900	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
18	61853.ENSNLEP00000021461	0.890	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
19	61853.ENSNLEP00000000748	0.888	ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
20	61853.ENSNLEP00000012727	0.888	Cytochrome c-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022857	0.959	transmembrane transporter activity
GO:0008324	0.525	monoatomic cation transmembrane transporter activity
GO:0015318	0.427	inorganic molecular entity transmembrane transporter activity
GO:0015078	0.399	proton transmembrane transporter activity
GO:0015267	0.343	channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065003	0.992	protein-containing complex assembly
GO:0042221	0.977	response to chemical
GO:1901700	0.949	response to oxygen-containing compound
GO:0046931	0.935	pore complex assembly
GO:0097305	0.925	response to alcohol
GO:0008152	0.741	metabolic process
GO:0045471	0.716	response to ethanol
GO:0044237	0.709	cellular metabolic process
GO:0071704	0.523	organic substance metabolic process
GO:0044238	0.515	primary metabolic process
GO:0009628	0.466	response to abiotic stimulus
GO:1901698	0.423	response to nitrogen compound
GO:0006807	0.414	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0031966	0.998	mitochondrial membrane
GO:0098800	0.941	inner mitochondrial membrane protein complex
GO:1902494	0.918	catalytic complex
GO:1990351	0.624	transporter complex
GO:1902495	0.590	transmembrane transporter complex
GO:0016469	0.379	proton-transporting two-sector ATPase complex
GO:0045259	0.314	proton-transporting ATP synthase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]