StarFunc result for job id P48378

User Input

>input (723 residues)
MQNSEGGADSPASVALRPSAAAPPVPASPQRVLVQAASSNPKGAQMQPISLPRVQQVPQQ
VQPVQHVYPAQVQYVEGGDAVYTNGAIRTAYTYNPEPQMYAPSSTASYFEAPGGAQVTVA
ASSPPAVPSHSMVGITMDVGGSPIVSSAGAYLIHGGMDSTRHSLAHTSRSSPATLEMAIE
NLQKSEGITSHKSGLLNSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLDPVNAAS
FGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPMHQKPR
YRPAQKTDSLGDSGSHSGLHSTPEQTMAVQSQHHQQYIDVSHVFPEFPAPDLGSFLLQDG
VTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDP
EGAVLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKS
LEGWLTNAMSDFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSD
LNRVDFANVQEQASWVCQCEESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHA
GSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAEA
TGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSL
QGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48378	1.000	1.000	1.083E-91	723	1.000	1.000	P48378.pdb.gz	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2
2	AFDB:P48379	0.788	0.794	1.008E-80	717	0.878	0.886	P48379.pdb.gz	RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus OX=10090 GN=Rfx2 PE=1 SV=2
3	AFDB:Q5EAP5	0.724	0.713	3.066E-72	734	0.748	0.737	Q5EAP5.pdb.gz	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
4	AFDB:P22670	0.522	0.395	1.129E-52	979	0.556	0.411	P22670.pdb.gz	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
5	AFDB:A0A0B4K621	0.497	0.423	1.471E-42	860	0.425	0.357	A0A0B4K621.pdb.gz	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
6	AFDB:Q8C7R7	0.371	0.294	6.826E-22	927	0.256	0.200	Q8C7R7.pdb.gz	RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus OX=10090 GN=Rfx6 PE=1 SV=2
7	AFDB:P48383	0.349	0.331	2.591E-16	766	0.172	0.162	P48383.pdb.gz	SAK1_SCHPO Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sak1 PE=1 SV=2
8	AFDB:Q5AMQ6	0.121	0.084	2.487E-6	1111	0.155	0.101	Q5AMQ6.pdb.gz	RFX2_CANAL RFX-like DNA-binding protein RFX2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RFX2 PE=2 SV=2
9	AFDB:B0M0P8	0.088	0.046	1.232E-3	2356	0.129	0.039	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
10	AFDB:Q811T9	0.064	0.058	3.084E-3	852	0.162	0.137	Q811T9.pdb.gz	DISC1_MOUSE Disrupted in schizophrenia 1 homolog OS=Mus musculus OX=10090 GN=Disc1 PE=1 SV=2
11	PDB:7qcdE	0.082	0.193	4.020E-1	261	0.022	0.061	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7qsoN	0.103	0.178	4.020E-1	347	0.033	0.069	7qsoN.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
13	PDB:1wa5B	0.075	0.102	6.502E-1	466	0.084	0.131	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
14	PDB:4m1mA	0.095	0.065	8.828E-1	1188	0.053	0.032	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
15	PDB:7tveF	0.096	0.222	8.828E-1	270	0.021	0.056	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
16	PDB:1c7dA	0.135	0.259	9.222E-1	284	0.044	0.113	1c7dA.pdb.gz	Genetically crosslinked hemoglobin: a structural study.
17	PDB:6h1cB	0.079	0.278	1.051	134	0.022	0.119	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
18	PDB:6qexA	0.094	0.064	1.428	1182	0.062	0.038	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
19	PDB:4etsB	0.082	0.262	1.558	149	0.022	0.107	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
20	PDB:4zzlA	0.070	0.233	1.558	146	0.028	0.137	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GV50	0.0	1273	692	0.862	0.900	RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus OX=10116 GN=Rfx2 PE=1 SV=1
2	P22670	0.0	753	979	0.552	0.408	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
3	P48377	0.0	749	963	0.552	0.414	RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus OX=10090 GN=Rfx1 PE=1 SV=2
4	P48378	0.0	1497	723	1.000	1.000	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2
5	P48379	0.0	1312	717	0.878	0.886	RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus OX=10090 GN=Rfx2 PE=1 SV=2
6	P48380	0.0	925	749	0.658	0.636	RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens OX=9606 GN=RFX3 PE=1 SV=2
7	P48381	0.0	925	749	0.656	0.633	RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus OX=10090 GN=Rfx3 PE=1 SV=2
8	Q32NR3	0.0	1111	694	0.762	0.794	RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis OX=8355 GN=rfx2 PE=2 SV=1
9	Q5EAP5	0.0	1048	734	0.759	0.748	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
10	A8JQX0	1.29e-177	532	889	0.385	0.313	A8JQX0_DROME Rfx, isoform I OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
11	Q9VGZ6	1.63e-177	532	897	0.385	0.310	Q9VGZ6_DROME Rfx, isoform J OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
12	A0A0B4K621	1.86e-177	531	860	0.385	0.323	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
13	A0A0B4K6P1	4.16e-177	531	911	0.385	0.305	A0A0B4K6P1_DROME Rfx, isoform C OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
14	Q9U1K2	5.61e-177	531	897	0.386	0.311	Q9U1K2_DROME RFX transcription factor OS=Drosophila melanogaster OX=7227 GN=Rfx PE=2 SV=1
15	A0A0B4KFL4	5.66e-177	530	882	0.385	0.315	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
16	A0A0B4K653	6.13e-177	531	919	0.385	0.303	A0A0B4K653_DROME Rfx, isoform H OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
17	Q33E94	7.98e-86	288	735	0.238	0.234	RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens OX=9606 GN=RFX4 PE=1 SV=2
18	Q7TNK1	9.94e-85	285	735	0.243	0.239	RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1
19	A2BGA0	1.13e-84	285	735	0.237	0.233	RFX4_DANRE Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1
20	Q5RJA1	1.93e-76	265	848	0.224	0.191	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10015 DUF2258	4.5e+02	12.4	Uncharacterized protein conserved in archaea (DUF2258)
2	PF03288 Pox_D5	2.1e+02	13.8	Poxvirus D5 protein-like
3	PF04589 RFX1_trans_act	2.1e-42	156.6	RFX1 transcription activation region
4	PF02257 RFX_DNA_binding	7.5e-30	114.7	RFX DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306335

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323880	0.957	Forkhead box protein J1
2	9606.ENSP00000426359	0.819	Multicilin
3	9606.ENSP00000428085	0.764	Ribosomal protein L30
4	9606.ENSP00000323580	0.740	Intraflagellar transport protein 88 homolog
5	9606.ENSP00000478589	0.662	Tetratricopeptide repeat protein 25
6	9606.ENSP00000262811	0.640	Microtubule associated serine/threonine kinase 3
7	9606.ENSP00000255476	0.626	Regulatory factor X-associated protein
8	9606.ENSP00000326022	0.609	Four and a half LIM domains protein 5
9	9606.ENSP00000305071	0.604	DNA-binding protein RFXANK
10	9606.ENSP00000358644	0.592	Protein FAM19A3
11	9606.ENSP00000322885	0.587	Probable E3 ubiquitin-protein ligase DTX2
12	9606.ENSP00000272321	0.586	WD repeat-containing and planar cell polarity effector protein fritz homolog
13	9606.ENSP00000304169	0.584	Pituitary homeobox 2
14	9606.ENSP00000260570	0.572	Intraflagellar transport protein 172 homolog
15	9606.ENSP00000362296	0.560	POU domain, class 3, transcription factor 4
16	9606.ENSP00000482968	0.554	Alstrom syndrome protein 1
17	9606.ENSP00000364028	0.553	Endothelin-converting enzyme 1
18	9606.ENSP00000406164	0.552	Geminin coiled-coil domain-containing protein 1
19	9606.ENSP00000264538	0.547	Intraflagellar transport protein 57 homolog
20	9606.ENSP00000374529	0.545	Cyclin-K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0005515	0.998	protein binding
GO:0000981	0.715	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.547	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.318	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.308	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0019219	0.937	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.920	regulation of macromolecule biosynthetic process
GO:0031326	0.920	regulation of cellular biosynthetic process
GO:0010468	0.918	regulation of gene expression
GO:0006355	0.914	regulation of DNA-templated transcription
GO:0009987	0.844	cellular process
GO:0006357	0.683	regulation of transcription by RNA polymerase II
GO:0032501	0.551	multicellular organismal process
GO:0032502	0.532	developmental process
GO:0071840	0.486	cellular component organization or biogenesis
GO:0016043	0.482	cellular component organization
GO:0048518	0.453	positive regulation of biological process
GO:0048856	0.430	anatomical structure development
GO:0048522	0.422	positive regulation of cellular process
GO:0010604	0.399	positive regulation of macromolecule metabolic process
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0031325	0.328	positive regulation of cellular metabolic process
GO:0045893	0.323	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.994	cytoplasm
GO:0043232	0.960	intracellular non-membrane-bounded organelle
GO:0032991	0.311	protein-containing complex
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]