StarFunc result for job id P48426

User Input

>input (406 residues)
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48426	1.000	1.000	2.628E-79	406	1.000	1.000	P48426.pdb.gz	PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2
2	AFDB:B3DJ34	0.925	0.929	3.270E-72	404	0.869	0.874	B3DJ34.pdb.gz	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
3	AFDB:A0A2R8RVI8	0.935	0.871	1.512E-67	437	0.867	0.805	A0A2R8RVI8.pdb.gz
4	AFDB:P78356	0.943	0.920	2.346E-66	416	0.771	0.752	P78356.pdb.gz	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
5	PDB:6ym4A	0.784	0.986	4.808E-58	322	0.771	0.972	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
6	AFDB:Q8TBX8	0.856	0.826	5.062E-58	421	0.643	0.620	Q8TBX8.pdb.gz	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
7	AFDB:Q8SXX1	0.897	0.901	1.688E-54	404	0.549	0.552	Q8SXX1.pdb.gz	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1
8	PDB:1bo1A	0.768	0.952	8.619E-48	326	0.631	0.785	1bo1A.pdb.gz
9	PDB:7em5B	0.715	0.974	6.831E-47	297	0.591	0.808	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
10	PDB:7n81B	0.717	0.939	4.537E-45	307	0.599	0.792	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
11	AFDB:Q9W2R3	0.736	0.392	2.345E-34	792	0.278	0.143	Q9W2R3.pdb.gz	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
12	AFDB:Q503I3	0.708	0.523	1.062E-33	559	0.298	0.216	Q503I3.pdb.gz	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
13	AFDB:A0A2R8QMJ9	0.720	0.505	2.198E-33	592	0.296	0.203	A0A2R8QMJ9.pdb.gz
14	AFDB:O01759	0.733	0.500	2.458E-33	611	0.281	0.187	O01759.pdb.gz	O01759_CAEEL PIPK domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ppk-1 PE=1 SV=2
15	PDB:2gk9B	0.595	0.957	4.450E-30	250	0.433	0.704	2gk9B.pdb.gz
16	PDB:6dflA	0.181	0.268	5.449E-2	241	0.044	0.075	6dflA.pdb.gz	Acylated-acyl carrier protein stabilizes the Pseudomonas aeruginosa WaaP lipopolysaccharide heptose kinase.
17	PDB:6fadC	0.200	0.221	9.015E-2	359	0.037	0.042	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
18	PDB:2qosC	0.081	0.154	1.261E-1	173	0.032	0.075	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
19	PDB:2ahcA	0.077	0.169	1.334E-1	164	0.049	0.122	2ahcA.pdb.gz	Structural analysis of ligand binding and catalysis in chorismate lyase
20	PDB:7snrB	0.051	0.114	1.334E-1	153	0.017	0.046	7snrB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DJ34	0.0	672	404	0.852	0.856	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
2	O70172	0.0	835	405	0.980	0.983	PI42A_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Mus musculus OX=10090 GN=Pip4k2a PE=1 SV=1
3	P48426	0.0	844	406	1.000	1.000	PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens OX=9606 GN=PIP4K2A PE=1 SV=2
4	P78356	0.0	602	416	0.773	0.755	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
5	Q80XI4	0.0	593	416	0.776	0.757	PI42B_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Mus musculus OX=10090 GN=Pip4k2b PE=1 SV=1
6	Q8TBX8	2.16e-178	505	421	0.643	0.620	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
7	O88370	1.32e-166	475	420	0.628	0.607	PI42C_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Rattus norvegicus OX=10116 GN=Pip4k2c PE=1 SV=1
8	Q8SXX1	5.64e-152	437	404	0.559	0.562	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1
9	Q55GN6	9.59e-53	189	719	0.318	0.179	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1
10	P38994	5.26e-50	182	779	0.318	0.166	MSS4_YEAST Phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS4 PE=1 SV=2
11	Q503I3	7.48e-46	167	559	0.296	0.215	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
12	A0A1D8PJ31	2.16e-45	168	718	0.313	0.177	A0A1D8PJ31_CANAL 1-phosphatidylinositol-4-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSS4 PE=4 SV=1
13	P70182	5.90e-44	162	546	0.276	0.205	PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus OX=10090 GN=Pip5k1a PE=1 SV=2
14	A6PW57	7.81e-44	162	550	0.283	0.209	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
15	Q99755	8.40e-44	162	562	0.283	0.205	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
16	D3ZSI8	1.07e-43	161	546	0.281	0.209	PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1
17	Q581R9	3.59e-43	159	481	0.278	0.235	Q581R9_TRYB2 Phosphatidylinositol 4-phosphate 5-kinase alpha, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.1030 PE=4 SV=1
18	O14986	6.07e-43	159	540	0.281	0.211	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
19	O13853	1.03e-42	161	742	0.288	0.158	ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=its3 PE=1 SV=3
20	P70181	2.76e-42	157	539	0.288	0.217	PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	3.7e-72	254.4	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010365864.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352147.1	0.996	Catalyzes the hydrolysis of phosphatidylinositol-4,5- bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P)
2	61622.XP_010375358.1	0.996	Transmembrane protein 55B
3	61622.XP_010352314.1	0.988	Phospholipase C delta 3
4	61622.XP_010353021.1	0.988	Phospholipase C zeta 1
5	61622.XP_010355559.1	0.988	Phospholipase C delta 1
6	61622.XP_010358076.1	0.988	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
7	61622.XP_010358540.1	0.988	Phospholipase C delta 4
8	61622.XP_010366432.1	0.988	Phospholipase C epsilon 1
9	61622.XP_010379598.1	0.988	Phospholipase C eta 1
10	61622.XP_010369261.1	0.987	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
11	61622.XP_010373447.1	0.987	Phospholipase C gamma 2
12	61622.XP_010374254.1	0.987	Phospholipase C gamma 1
13	61622.XP_010375377.1	0.987	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
14	61622.XP_010357799.1	0.985	Myotubularin related protein 3
15	61622.XP_010367729.1	0.985	Myotubularin related protein 14
16	61622.XP_010380714.1	0.963	Belongs to the PI3/PI4-kinase family
17	61622.XP_010350896.1	0.957	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 ESTs, 5 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
18	61622.XP_010365580.1	0.957	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform X1
19	61622.XP_010353579.1	0.956	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
20	61622.XP_010385510.1	0.955	Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016308	1.000	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0042802	0.842	identical protein binding
GO:0046983	0.605	protein dimerization activity
GO:0042803	0.554	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.985	cellular metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0046486	0.955	glycerolipid metabolic process
GO:0046488	0.953	phosphatidylinositol metabolic process
GO:0031323	0.927	regulation of cellular metabolic process
GO:0051179	0.923	localization
GO:0010506	0.919	regulation of autophagy
GO:0006661	0.881	phosphatidylinositol biosynthetic process
GO:0048519	0.837	negative regulation of biological process
GO:0048518	0.817	positive regulation of biological process
GO:0048522	0.788	positive regulation of cellular process
GO:0019220	0.775	regulation of phosphate metabolic process
GO:0071840	0.755	cellular component organization or biogenesis
GO:0006810	0.753	transport
GO:0016043	0.748	cellular component organization
GO:0042325	0.728	regulation of phosphorylation
GO:0080090	0.726	regulation of primary metabolic process
GO:0044087	0.701	regulation of cellular component biogenesis
GO:0048523	0.683	negative regulation of cellular process
GO:0051128	0.682	regulation of cellular component organization
GO:0048583	0.676	regulation of response to stimulus
GO:0050790	0.675	regulation of catalytic activity
GO:0009966	0.666	regulation of signal transduction
GO:0006996	0.664	organelle organization
GO:0019216	0.664	regulation of lipid metabolic process
GO:0009893	0.659	positive regulation of metabolic process
GO:0006914	0.655	autophagy
GO:0016050	0.651	vesicle organization
GO:0033043	0.645	regulation of organelle organization
GO:0045936	0.645	negative regulation of phosphate metabolic process
GO:0044088	0.641	regulation of vacuole organization
GO:0046854	0.619	phosphatidylinositol phosphate biosynthetic process
GO:0031325	0.601	positive regulation of cellular metabolic process
GO:0042326	0.597	negative regulation of phosphorylation
GO:0090174	0.595	organelle membrane fusion
GO:0048585	0.592	negative regulation of response to stimulus
GO:1902115	0.585	regulation of organelle assembly
GO:2000785	0.574	regulation of autophagosome assembly
GO:0016192	0.571	vesicle-mediated transport
GO:0033673	0.564	negative regulation of kinase activity
GO:0016241	0.557	regulation of macroautophagy
GO:0045833	0.550	negative regulation of lipid metabolic process
GO:0032501	0.548	multicellular organismal process
GO:0046627	0.535	negative regulation of insulin receptor signaling pathway
GO:0051130	0.514	positive regulation of cellular component organization
GO:0010508	0.513	positive regulation of autophagy
GO:0043550	0.508	regulation of lipid kinase activity
GO:1902117	0.502	positive regulation of organelle assembly
GO:0050896	0.490	response to stimulus
GO:0016239	0.480	positive regulation of macroautophagy
GO:0051716	0.406	cellular response to stimulus
GO:0032502	0.398	developmental process
GO:0007154	0.397	cell communication
GO:0048856	0.394	anatomical structure development
GO:0023052	0.388	signaling
GO:0007165	0.354	signal transduction
GO:0007275	0.306	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0005886	0.997	plasma membrane
GO:0005654	0.993	nucleoplasm
GO:0005773	0.992	vacuole
GO:0005776	0.793	autophagosome
GO:0012505	0.458	endomembrane system
GO:0031982	0.340	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	1.000	1-phosphatidylinositol-4-phosphate 5-kinase.

[back to server]