StarFunc result for job id P48431

User Input

>input (317 residues)
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMA
QENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM
KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGY
PQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A543	0.565	0.563	1.182E-42	319	0.984	0.978	D4A543.pdb.gz	D4A543_RAT SRY-box transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Sox2 PE=4 SV=1
2	AFDB:Q6P0E1	0.407	0.409	3.137E-35	315	0.874	0.879	Q6P0E1.pdb.gz	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
3	AFDB:Q9PSV6	0.361	0.362	2.058E-25	316	0.681	0.684	Q9PSV6.pdb.gz	Q9PSV6_CHICK SOX3 OS=Gallus gallus OX=9031 GN=Sox3 PE=2 SV=1
4	AFDB:P55863	0.455	0.466	9.849E-25	309	0.644	0.660	P55863.pdb.gz	SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis OX=8355 GN=sox3-a PE=1 SV=1
5	AFDB:P41225	0.370	0.273	1.110E-20	446	0.615	0.437	P41225.pdb.gz	SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens OX=9606 GN=SOX3 PE=1 SV=2
6	AFDB:O95416	0.280	0.368	1.097E-12	240	0.347	0.458	O95416.pdb.gz	SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens OX=9606 GN=SOX14 PE=1 SV=1
7	AFDB:B0ZTE1	0.283	0.341	2.476E-12	262	0.344	0.416	B0ZTE1.pdb.gz	SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis OX=8355 GN=sox21 PE=2 SV=1
8	AFDB:Q7SZS1	0.281	0.369	2.988E-12	239	0.306	0.406	Q7SZS1.pdb.gz	SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio OX=7955 GN=sox21a PE=2 SV=1
9	AFDB:Q6RVD7	0.278	0.356	8.663E-12	245	0.312	0.404	Q6RVD7.pdb.gz	SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio OX=7955 GN=sox21b PE=2 SV=1
10	AFDB:B0ZTE2	0.280	0.369	1.185E-11	239	0.322	0.427	B0ZTE2.pdb.gz	SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis OX=8355 GN=sox14 PE=2 SV=1
11	PDB:1j5nA	0.194	0.606	7.407E-3	93	0.063	0.215	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7fbyA	0.076	0.136	1.042	153	0.044	0.092	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
13	PDB:6dv9F	0.077	0.132	1.949	174	0.038	0.069	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
14	PDB:7ploI	0.143	0.102	2.075	451	0.032	0.022	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:6gdgA	0.095	0.110	2.666	264	0.028	0.034	6gdgA.pdb.gz	Cryo-EM structure of the adenosine A2Areceptor coupled to an engineered heterotrimeric G protein.
16	PDB:5x62B	0.076	0.065	3.646	387	0.038	0.031	5x62B.pdb.gz	Substrate Recognition Mechanism of the Putative Yeast Carnosine N-methyltransferase
17	PDB:2cyyA	0.077	0.156	4.133	151	0.041	0.086	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
18	PDB:6ta5D	0.089	0.085	4.400	345	0.019	0.017	6ta5D.pdb.gz
19	PDB:7n9sA	0.089	0.017	4.400	2365	0.035	0.005	7n9sA.pdb.gz
20	PDB:4i9qB	0.074	0.030	4.684	873	0.035	0.013	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U3FYV6	0.0	648	317	1.000	1.000	A0A0U3FYV6_HUMAN SRY (Sex determining region Y)-box 2 OS=Homo sapiens OX=9606 GN=SOX2 PE=4 SV=1
2	D4A543	0.0	636	319	0.984	0.978	D4A543_RAT SRY-box transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Sox2 PE=4 SV=1
3	O42569	0.0	505	311	0.868	0.884	SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis OX=8355 GN=sox2 PE=1 SV=1
4	P48430	0.0	585	315	0.934	0.940	SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus OX=9031 GN=SOX2 PE=1 SV=1
5	P48431	0.0	648	317	1.000	1.000	SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens OX=9606 GN=SOX2 PE=1 SV=1
6	P48432	0.0	546	319	0.953	0.947	SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus OX=10090 GN=Sox2 PE=1 SV=2
7	Q60I23	0.0	636	319	0.984	0.978	Q60I23_MOUSE SRY (sex determining region Y)-box 2 OS=Mus musculus OX=10090 GN=Sox2 PE=1 SV=1
8	Q6P0E1	7.20e-177	493	315	0.871	0.876	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
9	Q6EJB7	5.08e-126	364	300	0.650	0.687	SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio OX=7955 GN=sox3 PE=1 SV=1
10	Q9PSV6	3.77e-124	360	316	0.678	0.680	Q9PSV6_CHICK SOX3 OS=Gallus gallus OX=9031 GN=Sox3 PE=2 SV=1
11	P55863	3.18e-122	355	309	0.644	0.660	SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis OX=8355 GN=sox3-a PE=1 SV=1
12	P48433	6.46e-119	346	312	0.640	0.651	SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus OX=9031 GN=SOX3 PE=2 SV=1
13	P53784	1.10e-95	289	375	0.609	0.515	SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus OX=10090 GN=Sox3 PE=1 SV=2
14	Q2Z1R2	8.32e-94	283	340	0.634	0.591	SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio OX=7955 GN=sox1b PE=2 SV=1
15	Q6DGL6	1.83e-91	277	336	0.625	0.589	SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio OX=7955 GN=sox1a PE=2 SV=2
16	P41225	1.48e-90	279	446	0.552	0.392	SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens OX=9606 GN=SOX3 PE=1 SV=2
17	Q2PG84	1.29e-80	251	393	0.628	0.506	SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis OX=8355 GN=sox1 PE=2 SV=1
18	P47792	4.38e-79	244	297	0.530	0.566	SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio OX=7955 GN=sox19a PE=1 SV=2
19	Q9DDD7	2.07e-76	237	292	0.517	0.562	SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio OX=7955 GN=sox19b PE=1 SV=1
20	P53783	6.08e-73	232	391	0.599	0.486	SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus OX=10090 GN=Sox1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	3.8e-24	96.2	HMG (high mobility group) box
2	PF09011 HMG_box_2	2.6e-08	45.6	HMG-box domain
3	PF12336 SOXp	7.3e-34	128.0	SOX transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259915	0.999	POU domain, class 5, transcription factor 1
2	9606.ENSP00000229307	0.998	Homeobox protein NANOG
3	9606.ENSP00000344456	0.996	Catenin beta-1
4	9606.ENSP00000356840	0.995	POU domain, class 2, transcription factor 1
5	9606.ENSP00000392028	0.995	Chromodomain-helicase-DNA-binding protein 7
6	9606.ENSP00000404100	0.995	Paired box protein Pax-6
7	9606.ENSP00000217086	0.994	Sal-like protein 4
8	9606.ENSP00000363804	0.993	Krueppel-like factor 4
9	9606.ENSP00000479618	0.992	Myc proto-oncogene protein
10	9606.ENSP00000362649	0.990	Histone deacetylase 1
11	9606.ENSP00000264498	0.985	Fibroblast growth factor 2
12	9606.ENSP00000419298	0.982	Putative POU domain, class 5, transcription factor 1B
13	9606.ENSP00000360157	0.979	Forkhead box protein D3
14	9606.ENSP00000342626	0.977	Eyes absent homolog 1
15	9606.ENSP00000354487	0.975	Zinc finger E-box-binding homeobox 1
16	9606.ENSP00000251020	0.974	Sal-like protein 1
17	9606.ENSP00000363314	0.972	Protein lin-28 homolog A
18	9606.ENSP00000242261	0.969	Twist-related protein 1
19	9606.ENSP00000264657	0.968	Signal transducer and activator of transcription 3
20	9606.ENSP00000287538	0.968	Zinc finger protein ZIC 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:1990837	0.987	sequence-specific double-stranded DNA binding
GO:0000976	0.910	transcription cis-regulatory region binding
GO:0000981	0.862	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.341	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.997	regulation of metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.985	regulation of biosynthetic process
GO:0051252	0.984	regulation of RNA metabolic process
GO:0010468	0.983	regulation of gene expression
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0031326	0.981	regulation of cellular biosynthetic process
GO:0032502	0.974	developmental process
GO:0006355	0.970	regulation of DNA-templated transcription
GO:0032501	0.965	multicellular organismal process
GO:0007275	0.955	multicellular organism development
GO:0009987	0.945	cellular process
GO:0048518	0.857	positive regulation of biological process
GO:0048731	0.851	system development
GO:0048522	0.841	positive regulation of cellular process
GO:0048513	0.797	animal organ development
GO:0048519	0.744	negative regulation of biological process
GO:0009893	0.693	positive regulation of metabolic process
GO:0006357	0.693	regulation of transcription by RNA polymerase II
GO:0010604	0.681	positive regulation of macromolecule metabolic process
GO:0007399	0.651	nervous system development
GO:0048523	0.627	negative regulation of cellular process
GO:0050896	0.581	response to stimulus
GO:0051173	0.566	positive regulation of nitrogen compound metabolic process
GO:0031325	0.553	positive regulation of cellular metabolic process
GO:0009891	0.449	positive regulation of biosynthetic process
GO:0045935	0.447	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.442	positive regulation of RNA metabolic process
GO:0010557	0.440	positive regulation of macromolecule biosynthetic process
GO:0031328	0.440	positive regulation of cellular biosynthetic process
GO:0045893	0.432	positive regulation of DNA-templated transcription
GO:0009892	0.396	negative regulation of metabolic process
GO:0051172	0.384	negative regulation of nitrogen compound metabolic process
GO:0048869	0.366	cellular developmental process
GO:0030154	0.363	cell differentiation
GO:0010605	0.355	negative regulation of macromolecule metabolic process
GO:0045944	0.355	positive regulation of transcription by RNA polymerase II
GO:0009653	0.347	anatomical structure morphogenesis
GO:0048583	0.340	regulation of response to stimulus
GO:0051716	0.329	cellular response to stimulus
GO:0031324	0.324	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0005737	0.918	cytoplasm
GO:0005667	0.591	transcription regulator complex
GO:0043228	0.387	non-membrane-bounded organelle
GO:0005829	0.387	cytosol
GO:0043232	0.382	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]