StarFunc result for job id P48436

User Input

>input (509 residues)
MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDL
KKESEEDKFPVCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAAR
RKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRK
SVKNGQAEAEEATEQTHISPNAIFKALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTT
PKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPP
NGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPP
QPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY
SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPI
ADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O18896	0.281	0.281	5.096E-63	509	0.965	0.965	O18896.pdb.gz	SOX9_PIG Transcription factor SOX-9 OS=Sus scrofa OX=9823 GN=SOX9 PE=2 SV=1
2	AFDB:P48434	0.265	0.273	2.153E-55	494	0.851	0.877	P48434.pdb.gz	SOX9_CHICK Transcription factor SOX-9 OS=Gallus gallus OX=9031 GN=SOX9 PE=1 SV=3
3	AFDB:Q6F2E7	0.250	0.263	7.951E-53	482	0.811	0.857	Q6F2E7.pdb.gz	SOX9_XENTR Transcription factor Sox-9 OS=Xenopus tropicalis OX=8364 GN=sox9 PE=1 SV=1
4	AFDB:Q9DFH2	0.287	0.313	2.103E-45	462	0.717	0.790	Q9DFH2.pdb.gz	Q9DFH2_DANRE HMG box transcription factor Sox9a OS=Danio rerio OX=7955 GN=jef PE=2 SV=1
5	AFDB:P57074	0.271	0.291	4.066E-34	470	0.513	0.555	P57074.pdb.gz	SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus OX=9031 GN=SOX8 PE=2 SV=1
6	AFDB:Q9W757	0.226	0.245	2.220E-33	461	0.538	0.594	Q9W757.pdb.gz	SOX10_CHICK Transcription factor SOX-10 OS=Gallus gallus OX=9031 GN=SOX10 PE=2 SV=2
7	AFDB:A0A024R1N6	0.182	0.199	1.826E-32	466	0.536	0.586	A0A024R1N6.pdb.gz
8	AFDB:Q6VVD7	0.239	0.262	2.398E-31	459	0.511	0.566	Q6VVD7.pdb.gz	SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis OX=8355 GN=sox8 PE=2 SV=1
9	AFDB:Q04886	0.240	0.262	8.691E-31	464	0.475	0.522	Q04886.pdb.gz	SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus OX=10090 GN=Sox8 PE=2 SV=2
10	AFDB:Q90XD1	0.255	0.265	1.361E-29	485	0.487	0.511	Q90XD1.pdb.gz	Q90XD1_DANRE HMG-box transcription factor Sox10 OS=Danio rerio OX=7955 GN=cls/sox10 PE=2 SV=1
11	PDB:1j5nA	0.127	0.604	9.104E-2	93	0.035	0.194	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:5w3fB	0.052	0.057	1.910	427	0.008	0.009	5w3fB.pdb.gz	Structural differences between yeast and mammalian microtubules revealed by cryo-EM.
13	PDB:7mqaSS	0.048	0.063	3.855	350	0.045	0.066	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ksoC	0.059	0.068	4.334	420	0.037	0.045	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
15	PDB:7s78M	0.067	0.088	4.595	359	0.026	0.036	7s78M.pdb.gz	Structure of a Cell Entry Defective Human Adenovirus Provides Insights into Precursor Proteins and Capsid Maturation.
16	PDB:1tjlA	0.066	0.139	5.477	145	0.028	0.097	1tjlA.pdb.gz	Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription
17	PDB:4i4tA	0.063	0.069	5.477	447	0.018	0.020	4i4tA.pdb.gz	Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
18	PDB:5w3fA	0.062	0.069	5.477	440	0.018	0.020	5w3fA.pdb.gz	Structural differences between yeast and mammalian microtubules revealed by cryo-EM.
19	PDB:7aqrV	0.059	0.144	5.477	140	0.039	0.143	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
20	PDB:1gvhA	0.066	0.081	6.158	396	0.008	0.010	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZR65	0.0	766	477	0.811	0.866	SOX9A_XENLA Transcription factor Sox-9-A OS=Xenopus laevis OX=8355 GN=sox9-a PE=1 SV=1
2	F1LYL9	0.0	994	507	0.961	0.964	SOX9_RAT Transcription factor SOX-9 OS=Rattus norvegicus OX=10116 GN=Sox9 PE=1 SV=2
3	O18896	0.0	912	509	0.965	0.965	SOX9_PIG Transcription factor SOX-9 OS=Sus scrofa OX=9823 GN=SOX9 PE=2 SV=1
4	P48434	0.0	768	494	0.839	0.864	SOX9_CHICK Transcription factor SOX-9 OS=Gallus gallus OX=9031 GN=SOX9 PE=1 SV=3
5	P48436	0.0	1039	509	1.000	1.000	SOX9_HUMAN Transcription factor SOX-9 OS=Homo sapiens OX=9606 GN=SOX9 PE=1 SV=1
6	Q04887	0.0	1000	507	0.971	0.974	SOX9_MOUSE Transcription factor SOX-9 OS=Mus musculus OX=10090 GN=Sox9 PE=1 SV=2
7	Q6F2E7	0.0	777	482	0.804	0.849	SOX9_XENTR Transcription factor Sox-9 OS=Xenopus tropicalis OX=8364 GN=sox9 PE=1 SV=1
8	Q9DFH2	0.0	649	462	0.717	0.790	Q9DFH2_DANRE HMG box transcription factor Sox9a OS=Danio rerio OX=7955 GN=jef PE=2 SV=1
9	O55170	1.82e-158	460	466	0.521	0.569	SOX10_RAT Transcription factor SOX-10 OS=Rattus norvegicus OX=10116 GN=Sox10 PE=1 SV=1
10	Q04888	4.49e-158	459	466	0.517	0.564	SOX10_MOUSE Transcription factor SOX-10 OS=Mus musculus OX=10090 GN=Sox10 PE=1 SV=2
11	Q9W757	1.72e-157	457	461	0.525	0.579	SOX10_CHICK Transcription factor SOX-10 OS=Gallus gallus OX=9031 GN=SOX10 PE=2 SV=2
12	P56693	2.88e-157	457	466	0.513	0.560	SOX10_HUMAN Transcription factor SOX-10 OS=Homo sapiens OX=9606 GN=SOX10 PE=1 SV=1
13	Q8AXX8	3.62e-154	449	446	0.515	0.587	SOX10_XENLA Transcription factor Sox-10 OS=Xenopus laevis OX=8355 GN=sox10 PE=1 SV=1
14	Q9DFH1	3.52e-148	432	407	0.572	0.715	Q9DFH1_DANRE HMG box transcription factor Sox9b OS=Danio rerio OX=7955 GN=fb18d01 PE=2 SV=1
15	Q90XD1	2.39e-136	404	485	0.473	0.497	Q90XD1_DANRE HMG-box transcription factor Sox10 OS=Danio rerio OX=7955 GN=cls/sox10 PE=2 SV=1
16	Q6VVD7	5.06e-133	395	459	0.487	0.540	SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis OX=8355 GN=sox8 PE=2 SV=1
17	P57074	3.11e-131	391	470	0.530	0.574	SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus OX=9031 GN=SOX8 PE=2 SV=1
18	Q04886	1.13e-119	361	464	0.464	0.509	SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus OX=10090 GN=Sox8 PE=2 SV=2
19	P57073	8.95e-111	338	446	0.470	0.536	SOX8_HUMAN Transcription factor SOX-8 OS=Homo sapiens OX=9606 GN=SOX8 PE=2 SV=1
20	Q9VA16	1.08e-40	155	529	0.134	0.129	Q9VA16_DROME Sox100B protein OS=Drosophila melanogaster OX=7227 GN=Sox100B PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00505 HMG_box	7.2e-22	88.9	HMG (high mobility group) box
2	PF09011 HMG_box_2	5.6e-07	41.4	HMG-box domain
3	PF12444 Sox_N	7.2e-22	89.6	Sox developmental protein N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245479

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.996	Catenin beta-1
2	9606.ENSP00000263253	0.991	Histone acetyltransferase p300
3	9606.ENSP00000221496	0.983	Muellerian-inhibiting factor
4	9606.ENSP00000360493	0.983	Runt-related transcription factor 2
5	9606.ENSP00000371711	0.974	Doublesex- and mab-3-related transcription factor 1
6	9606.ENSP00000362690	0.972	Steroidogenic factor 1
7	9606.ENSP00000327048	0.967	Transcription factor Maf
8	9606.ENSP00000371790	0.967	Fibroblast growth factor 9
9	9606.ENSP00000266991	0.964	Desert hedgehog protein
10	9606.ENSP00000276079	0.943	Non-POU domain-containing octamer-binding protein
11	9606.ENSP00000334458	0.938	Transcription factor GATA-4
12	9606.ENSP00000360687	0.936	Prostaglandin-H2 D-isomerase
13	9606.ENSP00000360266	0.933	Transcription factor AP-1
14	9606.ENSP00000387356	0.909	Aggrecan core protein
15	9606.ENSP00000369889	0.908	Collagen alpha-1(II) chain
16	9606.ENSP00000363193	0.894	Mediator of RNA polymerase II transcription subunit 12
17	9606.ENSP00000333188	0.892	Forkhead box protein L2
18	9606.ENSP00000302961	0.887	Heat shock protein family A member 4
19	9606.ENSP00000368104	0.870	Bone morphogenetic protein 2
20	9606.ENSP00000327368	0.849	Collagen alpha-1(X) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0019899	0.583	enzyme binding
GO:0003682	0.450	chromatin binding
GO:0000977	0.443	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.325	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:1903508	0.990	positive regulation of nucleic acid-templated transcription
GO:0009987	0.986	cellular process
GO:0007275	0.986	multicellular organism development
GO:0045893	0.983	positive regulation of DNA-templated transcription
GO:0006357	0.982	regulation of transcription by RNA polymerase II
GO:0048731	0.977	system development
GO:0045944	0.968	positive regulation of transcription by RNA polymerase II
GO:0009888	0.966	tissue development
GO:0050896	0.963	response to stimulus
GO:0048513	0.957	animal organ development
GO:0051716	0.915	cellular response to stimulus
GO:0001501	0.864	skeletal system development
GO:0030154	0.830	cell differentiation
GO:0007548	0.810	sex differentiation
GO:0007154	0.786	cell communication
GO:0061448	0.785	connective tissue development
GO:0023052	0.766	signaling
GO:0048519	0.756	negative regulation of biological process
GO:0007165	0.664	signal transduction
GO:0048523	0.587	negative regulation of cellular process
GO:0046661	0.580	male sex differentiation
GO:0009653	0.553	anatomical structure morphogenesis
GO:0051239	0.462	regulation of multicellular organismal process
GO:0050793	0.461	regulation of developmental process
GO:0009892	0.440	negative regulation of metabolic process
GO:0071704	0.417	organic substance metabolic process
GO:0010605	0.413	negative regulation of macromolecule metabolic process
GO:0048583	0.409	regulation of response to stimulus
GO:0023051	0.403	regulation of signaling
GO:0051216	0.382	cartilage development
GO:0010646	0.368	regulation of cell communication
GO:0045137	0.365	development of primary sexual characteristics
GO:0008584	0.362	male gonad development
GO:0009966	0.355	regulation of signal transduction
GO:0044237	0.346	cellular metabolic process
GO:0060429	0.342	epithelium development
GO:0009887	0.342	animal organ morphogenesis
GO:0044238	0.329	primary metabolic process
GO:0003170	0.324	heart valve development
GO:2000026	0.309	regulation of multicellular organismal development
GO:0042127	0.305	regulation of cell population proliferation
GO:0045595	0.302	regulation of cell differentiation
GO:0031324	0.302	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0005737	0.443	cytoplasm
GO:0005667	0.407	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]