StarFunc result for job id P48454

User Input

>input (512 residues)
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48454	1.000	1.000	4.600E-99	512	1.000	1.000	P48454.pdb.gz	PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP3CC PE=1 SV=3
2	AFDB:E2CWF0	0.862	0.857	4.860E-84	515	0.859	0.854	E2CWF0.pdb.gz	E2CWF0_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
3	AFDB:P20651	0.854	0.835	5.470E-81	525	0.797	0.777	P20651.pdb.gz	PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp3cb PE=1 SV=1
4	AFDB:E2CWF1	0.777	0.821	3.211E-80	483	0.828	0.878	E2CWF1.pdb.gz	E2CWF1_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
5	AFDB:A0A0S2Z4C6	0.842	0.828	3.077E-77	521	0.801	0.787	A0A0S2Z4C6.pdb.gz	A0A0S2Z4C6_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP3CA PE=2 SV=1
6	AFDB:Q27889	0.833	0.751	1.012E-73	570	0.738	0.663	Q27889.pdb.gz	PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster OX=7227 GN=Pp2B-14D PE=1 SV=2
7	AFDB:Q0G819	0.835	0.790	4.308E-73	542	0.688	0.649	Q0G819.pdb.gz	PP2B_CAEEL Serine/threonine-protein phosphatase 2B catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=tax-6 PE=1 SV=2
8	AFDB:Q9VXF1	0.831	0.733	5.060E-73	584	0.721	0.632	Q9VXF1.pdb.gz	PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=CanA-14F PE=1 SV=4
9	AFDB:P48456	0.834	0.693	2.529E-72	622	0.715	0.588	P48456.pdb.gz	PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=CanA1 PE=2 SV=2
10	AFDB:O42773	0.798	0.644	1.438E-65	639	0.590	0.473	O42773.pdb.gz	PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNA1 PE=1 SV=1
11	PDB:4or9A	0.727	0.930	2.063E-62	399	0.668	0.857	4or9A.pdb.gz	Cooperative autoinhibition and multi-level activation mechanisms of calcineurin
12	PDB:4il1A	0.700	0.678	7.135E-60	529	0.637	0.616	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
13	PDB:2nppC	0.543	0.888	8.833E-31	308	0.234	0.390	2nppC.pdb.gz	Structure of the protein phosphatase 2A holoenzyme
14	PDB:7obeA	0.560	0.597	2.214E-28	480	0.240	0.256	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
15	PDB:1s70A	0.543	0.889	2.896E-28	309	0.209	0.346	1s70A.pdb.gz	Structural basis of protein phosphatase 1 regulation
16	PDB:1wao1	0.563	0.611	4.692E-28	471	0.238	0.259	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
17	PDB:6zejI	0.544	0.786	1.793E-27	351	0.209	0.305	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
18	PDB:1g5bB	0.276	0.591	1.923E-8	221	0.092	0.213	1g5bB.pdb.gz	Structure of the bacteriophage lambda Ser/Thr protein phosphatase with sulfate ion bound in two coordination modes.
19	PDB:5vjvA	0.277	0.442	3.918E-4	298	0.100	0.171	5vjvA.pdb.gz	Structural basis for the preference of the Arabidopsis thalianaphosphatase RLPH2 for tyrosine-phosphorylated substrates.
20	PDB:3ib7A	0.220	0.338	1.580E-3	295	0.062	0.108	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K820	917	496	0.855	0.883	A0A0G2K820_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=3 SV=1
2	A0A0S2Z4B5	859	511	0.785	0.787	A0A0S2Z4B5_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP3CA PE=2 SV=1
3	A0A0S2Z4C6	884	521	0.801	0.787	A0A0S2Z4C6_HUMAN Serine/threonine-protein phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=PPP3CA PE=2 SV=1
4	A0A1D8PCA8	538	609	0.512	0.430	A0A1D8PCA8_CANAL Serine/threonine-protein phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CMP1 PE=3 SV=1
5	A0A8I6GLU2	913	505	0.842	0.853	A0A8I6GLU2_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=3 SV=1
6	A0A8J8XJJ2	909	502	0.840	0.857	A0A8J8XJJ2_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=3 SV=1
7	B9W6M3	540	607	0.514	0.433	B9W6M3_CANDC Serine/threonine-protein phosphatase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CNA1 PE=3 SV=1
8	E2CWF0	930	515	0.861	0.856	E2CWF0_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
9	E2CWF1	893	483	0.832	0.882	E2CWF1_RAT Serine/threonine-protein phosphatase OS=Rattus norvegicus OX=10116 GN=Ppp3cc PE=2 SV=1
10	O42773	629	639	0.596	0.477	PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNA1 PE=1 SV=1
11	P14747	523	604	0.518	0.439	PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CMP2 PE=1 SV=2
12	P16298	876	524	0.801	0.782	PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP3CB PE=1 SV=2
13	P20651	870	525	0.799	0.779	PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp3cb PE=1 SV=1
14	P23287	527	553	0.508	0.470	PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNA1 PE=1 SV=2
15	P48452	883	521	0.801	0.787	PP2BA_BOVIN Protein phosphatase 3 catalytic subunit alpha OS=Bos taurus OX=9913 GN=PPP3CA PE=1 SV=1
16	P48453	874	525	0.801	0.781	PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Ppp3cb PE=1 SV=2
17	P48454	1075	512	1.000	1.000	PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP3CC PE=1 SV=3
18	P48455	936	513	0.871	0.869	PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp3cc PE=1 SV=1
19	P48456	766	622	0.701	0.577	PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster OX=7227 GN=CanA1 PE=2 SV=2
20	P48457	624	549	0.582	0.543	PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cnaA PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17349 DUF5378	1.5e+02	13.1	Family of unknown function (DUF5378)
2	PF00149 Metallophos	2.8e-35	134.2	Calcineurin-like phosphoesterase
3	PF10409 PTEN_C2	2e+02	13.1	C2 domain of PTEN tumour-suppressor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000034353

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000020610	0.992	Protein phosphatase 3 regulatory subunit B, alpha
2	9598.ENSPTRP00000004567	0.982	Serine/threonine-protein phosphatase
3	9598.ENSPTRP00000049331	0.971	Uncharacterized protein
4	9598.ENSPTRP00000028026	0.955	Protein phosphatase 3, catalytic subunit, alpha isozyme
5	9598.ENSPTRP00000006585	0.923	Pan troglodytes BCL2-associated agonist of cell death (BAD), mRNA
6	9598.ENSPTRP00000015498	0.911	Protein phosphatase 1, regulatory (inhibitor) subunit 1B
7	9598.ENSPTRP00000014330	0.910	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
8	9598.ENSPTRP00000023178	0.910	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
9	9598.ENSPTRP00000047128	0.909	Uncharacterized protein
10	9598.ENSPTRP00000026315	0.898	Glycogen synthase kinase 3 beta
11	9598.ENSPTRP00000014100	0.897	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
12	9598.ENSPTRP00000019197	0.880	Calmodulin 1 (Phosphorylase kinase, delta)
13	9598.ENSPTRP00000008585	0.876	Protein phosphatase 1, regulatory (inhibitor) subunit 1A
14	9598.ENSPTRP00000015290	0.852	Slingshot protein phosphatase 2
15	9598.ENSPTRP00000045966	0.852	Slingshot homolog 3
16	9598.ENSPTRP00000007742	0.842	Voltage-dependent L-type calcium channel subunit alpha
17	9598.ENSPTRP00000025959	0.837	Voltage-dependent L-type calcium channel subunit alpha
18	9598.ENSPTRP00000002298	0.835	Uncharacterized protein
19	9598.ENSPTRP00000010557	0.823	Uncharacterized protein
20	9598.ENSPTRP00000000267	0.809	TAR DNA binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004723	0.996	calcium-dependent protein serine/threonine phosphatase activity
GO:0033192	0.402	calmodulin-dependent protein phosphatase activity
GO:0043167	0.395	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0008152	0.933	metabolic process
GO:0071704	0.891	organic substance metabolic process
GO:0044237	0.880	cellular metabolic process
GO:0044238	0.853	primary metabolic process
GO:0006807	0.739	nitrogen compound metabolic process
GO:0006796	0.712	phosphate-containing compound metabolic process
GO:0050896	0.709	response to stimulus
GO:0016311	0.695	dephosphorylation
GO:0043170	0.678	macromolecule metabolic process
GO:0048518	0.676	positive regulation of biological process
GO:1901564	0.653	organonitrogen compound metabolic process
GO:0048522	0.647	positive regulation of cellular process
GO:0019538	0.632	protein metabolic process
GO:0032501	0.582	multicellular organismal process
GO:0036211	0.539	protein modification process
GO:0006470	0.499	protein dephosphorylation
GO:0032502	0.473	developmental process
GO:0048856	0.462	anatomical structure development
GO:0051716	0.462	cellular response to stimulus
GO:0007165	0.451	signal transduction
GO:0019222	0.331	regulation of metabolic process
GO:0007275	0.324	multicellular organism development
GO:0060255	0.301	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0005829	0.983	cytosol
GO:0032991	0.967	protein-containing complex
GO:0030054	0.967	cell junction
GO:0043227	0.967	membrane-bounded organelle
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0045202	0.911	synapse
GO:0070013	0.854	intracellular organelle lumen
GO:0005634	0.814	nucleus
GO:0016020	0.641	membrane
GO:0098793	0.594	presynapse
GO:0031981	0.591	nuclear lumen
GO:0005654	0.578	nucleoplasm
GO:1902494	0.577	catalytic complex
GO:0098978	0.443	glutamatergic synapse
GO:0071944	0.389	cell periphery
GO:0005886	0.383	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]