StarFunc result for job id P48507

User Input

>input (274 residues)
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O09172	0.997	0.997	1.678E-58	274	0.964	0.964	O09172.pdb.gz	GSH0_MOUSE Glutamate--cysteine ligase regulatory subunit OS=Mus musculus OX=10090 GN=Gclm PE=1 SV=1
2	AFDB:Q9VCW6	0.723	0.696	1.773E-23	285	0.307	0.295	Q9VCW6.pdb.gz	Q9VCW6_DROME GCS light chain OS=Drosophila melanogaster OX=7227 GN=Gclm PE=1 SV=1
3	AFDB:Q966L2	0.785	0.780	2.577E-23	276	0.292	0.290	Q966L2.pdb.gz	Q966L2_CAEEL GCS light chain OS=Caenorhabditis elegans OX=6239 GN=CELE_E01A2.1 PE=1 SV=1
4	AFDB:O94246	0.732	0.701	1.573E-20	287	0.219	0.209	O94246.pdb.gz	GSH0_SCHPO Putative glutamate--cysteine ligase regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC737.06c PE=3 SV=1
5	AFDB:Q6IMN8	0.358	0.331	8.615E-8	297	0.128	0.118	Q6IMN8.pdb.gz	ALRA_DICDI Aldose reductase A OS=Dictyostelium discoideum OX=44689 GN=alrA PE=1 SV=1
6	AFDB:Q96JD6	0.349	0.302	2.060E-7	320	0.153	0.131	Q96JD6.pdb.gz	AKCL2_HUMAN 1,5-anhydro-D-fructose reductase OS=Homo sapiens OX=9606 GN=AKR1E2 PE=1 SV=2
7	AFDB:G5EB57	0.348	0.300	3.608E-7	325	0.153	0.129	G5EB57.pdb.gz	G5EB57_EMENI D-xylose reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05563 PE=4 SV=1
8	AFDB:M9PF61	0.348	0.278	4.349E-7	350	0.146	0.114	M9PF61.pdb.gz	M9PF61_DROME Aldo-keto reductase 1B, isoform C OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=1
9	PDB:3h7uA	0.364	0.322	7.335E-7	312	0.120	0.106	3h7uA.pdb.gz	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.
10	AFDB:B4F9A4	0.366	0.322	7.618E-7	314	0.124	0.108	B4F9A4.pdb.gz	DMAS1_MAIZE Deoxymugineic acid synthase 1 OS=Zea mays OX=4577 GN=DMAS1 PE=1 SV=1
11	AFDB:Q2UJW6	0.344	0.295	7.618E-7	325	0.142	0.120	Q2UJW6.pdb.gz	Q2UJW6_ASPOR D-xylose reductase [NAD(P)H] OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001045 PE=4 SV=1
12	PDB:3burA	0.352	0.300	1.001E-6	325	0.146	0.123	3burA.pdb.gz	Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
13	PDB:3h7rA	0.348	0.312	1.455E-6	307	0.124	0.111	3h7rA.pdb.gz	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.
14	PDB:4l1wA	0.332	0.282	1.867E-6	325	0.139	0.117	4l1wA.pdb.gz	Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
15	PDB:4ijcA	0.340	0.286	2.250E-6	330	0.146	0.121	4ijcA.pdb.gz
16	PDB:3ln3A	0.363	0.314	2.887E-6	319	0.142	0.122	3ln3A.pdb.gz	Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
17	PDB:3cv6A	0.331	0.284	4.464E-6	323	0.135	0.115	3cv6A.pdb.gz	Structure of the G225P/G226P mutant of mouse 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) ternary complex: implications for the binding of inhibitor and substrate.
18	PDB:4gacA	0.370	0.316	4.464E-6	324	0.099	0.083	4gacA.pdb.gz
19	PDB:3rx2A	0.358	0.313	6.486E-6	318	0.131	0.113	3rx2A.pdb.gz	The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
20	PDB:2fvlA	0.362	0.309	7.818E-6	323	0.109	0.093	2fvlA.pdb.gz	Crystal structure of human 3-alpha hydroxysteroid/dihydrodiol dehydrogenase (AKR1C4) complexed with NADP+

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09172	0.0	505	274	0.964	0.964	GSH0_MOUSE Glutamate--cysteine ligase regulatory subunit OS=Mus musculus OX=10090 GN=Gclm PE=1 SV=1
2	P48507	0.0	564	274	1.000	1.000	GSH0_HUMAN Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1
3	P48508	0.0	523	274	0.960	0.960	GSH0_RAT Glutamate--cysteine ligase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Gclm PE=1 SV=1
4	Q9VCW6	3.40e-31	119	285	0.314	0.302	Q9VCW6_DROME GCS light chain OS=Drosophila melanogaster OX=7227 GN=Gclm PE=1 SV=1
5	Q966L2	1.01e-30	117	276	0.328	0.326	Q966L2_CAEEL GCS light chain OS=Caenorhabditis elegans OX=6239 GN=CELE_E01A2.1 PE=1 SV=1
6	O94246	4.80e-18	84.0	287	0.208	0.199	GSH0_SCHPO Putative glutamate--cysteine ligase regulatory subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC737.06c PE=3 SV=1
7	Q07551	4.05e-06	49.7	312	0.120	0.106	KAR_YEAST NADPH-dependent alpha-keto amide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDL124W PE=1 SV=1
8	Q6IMN8	6.73e-06	48.9	297	0.161	0.148	ALRA_DICDI Aldose reductase A OS=Dictyostelium discoideum OX=44689 GN=alrA PE=1 SV=1
9	Q9GV41	7.51e-05	45.4	276	0.113	0.112	PGFS_TRYBB 9,11-endoperoxide prostaglandin H2 reductase OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=1
10	Q2UJW6	0.003	40.8	325	0.062	0.052	Q2UJW6_ASPOR D-xylose reductase [NAD(P)H] OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001045 PE=4 SV=1
11	P27800	0.011	38.9	323	0.139	0.118	ALDX_SPOSA Aldehyde reductase 1 OS=Sporidiobolus salmonicolor OX=5005 GN=ARI PE=1 SV=3
12	Q10494	0.015	38.5	321	0.109	0.093	YDG7_SCHPO Uncharacterized oxidoreductase C26F1.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26F1.07 PE=3 SV=1
13	P47137	0.017	38.5	282	0.113	0.110	YJ66_YEAST Uncharacterized oxidoreductase YJR096W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJR096W PE=1 SV=1
14	G5EB57	0.024	38.1	325	0.066	0.055	G5EB57_EMENI D-xylose reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05563 PE=4 SV=1
15	Q0PGJ6	0.037	37.4	315	0.117	0.102	AKRC9_ARATH NADPH-dependent aldo-keto reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AKR4C9 PE=1 SV=1
16	Q9M338	0.061	37.0	315	0.117	0.102	AKRCB_ARATH Aldo-keto reductase family 4 member C11 OS=Arabidopsis thaliana OX=3702 GN=AKR4C11 PE=1 SV=1
17	A0A0H2UQQ5	0.081	36.2	280	0.131	0.129	A0A0H2UQQ5_STRPN Oxidoreductase, aldo/keto reductase family OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1478 PE=1 SV=1
18	M9PF61	0.19	35.4	350	0.066	0.051	M9PF61_DROME Aldo-keto reductase 1B, isoform C OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=1
19	M9PI17	0.19	35.4	316	0.066	0.057	M9PI17_DROME Aldo-keto reductase 1B, isoform D OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=1
20	Q8IQF8	0.19	35.4	350	0.066	0.051	Q8IQF8_DROME AT18092p OS=Drosophila melanogaster OX=7227 GN=Akr1B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	0.015	26.0	Aldo/keto reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229416	0.999	Glutamate-cysteine ligase catalytic subunit
2	9606.ENSP00000216951	0.979	Glutathione synthetase
3	9606.ENSP00000338964	0.963	Glutathione hydrolase 7
4	9606.ENSP00000381340	0.962	Glutathione hydrolase 5 proenzyme
5	9606.ENSP00000370962	0.959	Glutathione hydrolase 6
6	9606.ENSP00000383232	0.949	Glutathione hydrolase 1 proenzyme
7	9606.ENSP00000443459	0.934	Branched-chain-amino-acid aminotransferase, cytosolic
8	9606.ENSP00000322991	0.932	Branched-chain-amino-acid aminotransferase, mitochondrial
9	9606.ENSP00000226299	0.920	Cytosol aminopeptidase
10	9606.ENSP00000275428	0.917	Gamma-glutamylcyclotransferase
11	9606.ENSP00000480476	0.912	5-oxoprolinase
12	9606.ENSP00000325548	0.911	Cytosolic non-specific dipeptidase
13	9606.ENSP00000300060	0.908	Aminopeptidase N
14	9606.ENSP00000231420	0.904	Alanine--glyoxylate aminotransferase 2, mitochondrial
15	9606.ENSP00000319788	0.895	NAD(P)H dehydrogenase [quinone] 1
16	9606.ENSP00000171111	0.891	Kelch-like ECH-associated protein 1
17	9606.ENSP00000359976	0.867	Cystathionine gamma-lyase
18	9606.ENSP00000216117	0.857	Heme oxygenase 1
19	9606.ENSP00000310447	0.849	Glutaminase liver isoform, mitochondrial
20	9606.ENSP00000277865	0.846	Glutamate dehydrogenase 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035226	1.000	glutamate-cysteine ligase catalytic subunit binding
GO:0016879	0.995	ligase activity, forming carbon-nitrogen bonds
GO:0016881	0.993	acid-amino acid ligase activity
GO:0016491	0.546	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0043604	0.987	amide biosynthetic process
GO:0006749	0.978	glutathione metabolic process
GO:0019184	0.976	nonribosomal peptide biosynthetic process
GO:0050896	0.969	response to stimulus
GO:0065007	0.957	biological regulation
GO:0042221	0.954	response to chemical
GO:0006950	0.928	response to stress
GO:0044238	0.905	primary metabolic process
GO:0044281	0.860	small molecule metabolic process
GO:0006082	0.756	organic acid metabolic process
GO:0043436	0.750	oxoacid metabolic process
GO:0006979	0.746	response to oxidative stress
GO:0019752	0.675	carboxylic acid metabolic process
GO:0050789	0.555	regulation of biological process
GO:0051716	0.439	cellular response to stimulus
GO:0070887	0.424	cellular response to chemical stimulus
GO:0050794	0.407	regulation of cellular process
GO:0006520	0.320	amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0005737	1.000	cytoplasm
GO:0005829	0.984	cytosol
GO:0017109	0.523	glutamate-cysteine ligase complex
GO:0043226	0.353	organelle
GO:0043227	0.311	membrane-bounded organelle
GO:0043231	0.304	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.3.-.-	0.995	Forming carbon-nitrogen bonds.
EC:6.3.2.-	0.993	Acid--amino-acid ligases (peptide synthases).
EC:1.-.-.-	0.546	Oxidoreductases.

[back to server]