StarFunc result for job id P48539

User Input

>input (62 residues)
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGS
QS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48539	1.000	1.000	6.432E-9	62	1.000	1.000	P48539.pdb.gz	PCP4_HUMAN Calmodulin regulator protein PCP4 OS=Homo sapiens OX=9606 GN=PCP4 PE=1 SV=3
2	AFDB:P22804	0.397	0.181	2.827	142	0.145	0.063	P22804.pdb.gz	BET1_YEAST Protein transport protein BET1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BET1 PE=1 SV=1
3	AFDB:Q386P6	0.310	0.045	3.324	486	0.161	0.021	Q386P6.pdb.gz	Q386P6_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0240 PE=4 SV=1
4	AFDB:P05031	0.291	0.042	3.604	510	0.210	0.025	P05031.pdb.gz	DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster OX=7227 GN=Ddc PE=1 SV=4
5	AFDB:A0A024R5S5	0.351	0.089	4.594	258	0.177	0.043	A0A024R5S5.pdb.gz
6	AFDB:P9WLG7	0.408	0.137	5.401	196	0.177	0.056	P9WLG7.pdb.gz	Y2240_MYCTU Uncharacterized protein Rv2240c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2240c PE=1 SV=1
7	AFDB:Q7JPS2	0.484	0.146	5.401	240	0.226	0.058	Q7JPS2.pdb.gz	Q7JPS2_DROME Igloo, isoform A OS=Drosophila melanogaster OX=7227 GN=igl PE=1 SV=1
8	AFDB:Q8ILW0	0.269	0.071	5.856	347	0.065	0.012	Q8ILW0.pdb.gz	Q8ILW0_PLAF7 FeS assembly ATPase SufC OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1413500 PE=4 SV=1
9	AFDB:Q9LDD8	0.379	0.042	5.856	587	0.113	0.012	Q9LDD8.pdb.gz	MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCB PE=2 SV=1
10	AFDB:O14468	0.400	0.331	6.349	76	0.161	0.132	O14468.pdb.gz	YO304_YEAST Uncharacterized protein YOR304C-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR304C-A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48539	1.04e-38	123	62	1.000	1.000	PCP4_HUMAN Calmodulin regulator protein PCP4 OS=Homo sapiens OX=9606 GN=PCP4 PE=1 SV=3
2	P63054	2.44e-37	120	62	0.968	0.968	PCP4_MOUSE Calmodulin regulator protein PCP4 OS=Mus musculus OX=10090 GN=Pcp4 PE=3 SV=2
3	P63055	2.44e-37	120	62	0.968	0.968	PCP4_RAT Calmodulin regulator protein PCP4 OS=Rattus norvegicus OX=10116 GN=Pcp4 PE=1 SV=2
4	Q7JPS2	5.89e-04	37.7	240	0.274	0.071	Q7JPS2_DROME Igloo, isoform A OS=Drosophila melanogaster OX=7227 GN=igl PE=1 SV=1
5	Q95T29	8.91e-04	36.6	122	0.274	0.139	Q95T29_DROME GEO06276p1 OS=Drosophila melanogaster OX=7227 GN=igl PE=1 SV=1
6	P25297	0.25	30.4	587	0.210	0.022	PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO84 PE=1 SV=2
7	Q18237	1.2	28.5	1076	0.242	0.014	SMC5_CAEEL Structural maintenance of chromosomes protein 5 OS=Caenorhabditis elegans OX=6239 GN=smc-5 PE=1 SV=2
8	P97521	6.9	26.2	301	0.194	0.040	MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a20 PE=1 SV=1
9	Q8HCN1	9.0	25.8	172	0.226	0.081	Q8HCN1_ORYSJ Ribosomal protein S1 OS=Oryza sativa subsp. japonica OX=39947 GN=rps1 PE=4 SV=2
10	Q9DG88	9.1	26.2	1838	0.226	0.008	Q9DG88_MORSA Myosin heavy chain FM3A OS=Morone saxatilis OX=34816 GN=FM3A PE=2 SV=1
11	Q9VAU1	9.6	26.2	808	0.210	0.016	Q9VAU1_DROME Snustorr, isoform A OS=Drosophila melanogaster OX=7227 GN=snu PE=1 SV=1
12	Q2F910	9.8	25.8	172	0.226	0.081	Q2F910_ORYSJ Ribosomal protein S1 OS=Oryza sativa subsp. japonica OX=39947 GN=rps1 PE=4 SV=1
13	Q2F963	9.8	25.8	172	0.226	0.081	Q2F963_ORYSI Ribosomal protein S1 OS=Oryza sativa subsp. indica OX=39946 GN=rps1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00612 IQ	64	14.7	IQ calmodulin-binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006158231.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006146340.1	0.692	Single-minded like protein 2
2	246437.XP_006172129.1	0.645	Netrin-G2
3	246437.XP_006150390.1	0.569	Reticulocyte-binding protein 2 homolog a isoform X1
4	246437.XP_006153282.1	0.563	PDZ binding kinase
5	246437.XP_006147220.1	0.560	Homer protein homolog 3
6	246437.XP_006156429.1	0.528	ATP-binding cassette sub-family G member 1 isoform X1
7	246437.XP_006163500.1	0.519	Synaptotagmin-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005516	1.000	calmodulin binding
GO:0043167	0.936	ion binding
GO:0005509	0.907	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0032501	0.958	multicellular organismal process
GO:0048519	0.952	negative regulation of biological process
GO:0019222	0.952	regulation of metabolic process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0031323	0.934	regulation of cellular metabolic process
GO:0080090	0.931	regulation of primary metabolic process
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0048518	0.919	positive regulation of biological process
GO:0007154	0.913	cell communication
GO:0050896	0.906	response to stimulus
GO:0048523	0.905	negative regulation of cellular process
GO:0023052	0.904	signaling
GO:0051716	0.880	cellular response to stimulus
GO:0048522	0.852	positive regulation of cellular process
GO:0032502	0.842	developmental process
GO:0051049	0.832	regulation of transport
GO:0051174	0.722	regulation of phosphorus metabolic process
GO:0051952	0.708	regulation of amine transport
GO:0007165	0.692	signal transduction
GO:1901214	0.681	regulation of neuron death
GO:0050793	0.678	regulation of developmental process
GO:0051046	0.662	regulation of secretion
GO:0051246	0.660	regulation of protein metabolic process
GO:0050433	0.648	regulation of catecholamine secretion
GO:0065009	0.620	regulation of molecular function
GO:0001503	0.574	ossification
GO:0045664	0.505	regulation of neuron differentiation
GO:0051094	0.468	positive regulation of developmental process
GO:0031399	0.462	regulation of protein modification process
GO:0019220	0.458	regulation of phosphate metabolic process
GO:0042325	0.443	regulation of phosphorylation
GO:0048856	0.441	anatomical structure development
GO:0009892	0.409	negative regulation of metabolic process
GO:0042981	0.392	regulation of apoptotic process
GO:0031324	0.391	negative regulation of cellular metabolic process
GO:0051172	0.384	negative regulation of nitrogen compound metabolic process
GO:0010605	0.384	negative regulation of macromolecule metabolic process
GO:0051128	0.378	regulation of cellular component organization
GO:0007275	0.350	multicellular organism development
GO:0030154	0.342	cell differentiation
GO:0014059	0.324	regulation of dopamine secretion
GO:0001649	0.306	osteoblast differentiation
GO:1901215	0.306	negative regulation of neuron death
GO:0051954	0.305	positive regulation of amine transport
GO:0033673	0.303	negative regulation of kinase activity
GO:0031400	0.300	negative regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0005829	0.987	cytosol
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005634	0.981	nucleus
GO:0032991	0.958	protein-containing complex
GO:0043232	0.919	intracellular non-membrane-bounded organelle
GO:0071944	0.918	cell periphery
GO:0016020	0.878	membrane
GO:0005856	0.565	cytoskeleton
GO:0005886	0.553	plasma membrane
GO:0043005	0.507	neuron projection
GO:0045111	0.478	intermediate filament cytoskeleton
GO:0005654	0.385	nucleoplasm
GO:0030424	0.377	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]