StarFunc result for job id P48552

User Input

>input (1158 residues)
MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPT
CQSNGPVLNTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMV
DSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHDSLKVEKDLRCYGV
ASSHLKTLLKKSKVKDQKPDTNLPDVTKNLIRDRFAESPHHVGQSGTKVMSEPLSCAARL
QAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAA
MARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNA
GYKNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDN
NPSFTDDSSGDESSYSNCVPIDLSCKHRTEKSESDQPVSLDNFTQSLLNTWDPKVPDVDI
KEDQDTSKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHNDVSKFNTQNYARTSVI
ESPSTNRTTPVSTPPLLTSSKAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSM
DLTKSKDPPGEKPAQNEGAQNSATFSASKLLQNLAQCGMQSSMSVEEQRPSKQLLTGNTD
KPIGMIDRLNSPLLSNKTNAVEENKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGNP
NKGKSEKKEKTPLRDESTQEHSERALSEQILMVKIKSEPCDDLQIPNTNVHLSHDAKSAP
FLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHR
NNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEEL
KFSRNDLEFKYPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADS
KKKGHKNNVTNSKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGC
AGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPILYYMLQKGGNSVT
SRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSAN
GEVYGLLGSVLTIKKESE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48552	1.000	1.000	0.000	1158	1.000	1.000	P48552.pdb.gz	NRIP1_HUMAN Nuclear receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=NRIP1 PE=1 SV=2
2	AFDB:Q1G7G9	0.040	0.033	1.056E-7	1523	0.165	0.125	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
3	AFDB:Q24079	0.038	0.037	5.315E-7	1221	0.146	0.138	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
4	AFDB:Q9S7I0	0.052	0.047	5.315E-7	1307	0.122	0.108	Q9S7I0.pdb.gz	TADA_ARATH tRNA(adenine(34)) deaminase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TADA PE=1 SV=1
5	AFDB:H6D7E6	0.052	0.040	2.717E-5	1554	0.135	0.100	H6D7E6.pdb.gz	TALD3_DANRE Protein TALPID3 OS=Danio rerio OX=7955 GN=talpid3 PE=2 SV=1
6	AFDB:Q96M83	0.052	0.045	1.811E-4	1385	0.156	0.131	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
7	AFDB:E9PV87	0.046	0.038	2.084E-4	1520	0.140	0.107	E9PV87.pdb.gz	TALD3_MOUSE Protein TALPID3 OS=Mus musculus OX=10090 GN=Talpid3 PE=1 SV=1
8	AFDB:F1RCC9	0.063	0.062	2.236E-4	1179	0.138	0.136	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
9	AFDB:Q388G0	0.061	0.052	2.399E-4	1506	0.149	0.115	Q388G0.pdb.gz	Q388G0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2330 PE=4 SV=1
10	AFDB:Q6PAC4	0.054	0.050	2.399E-4	1279	0.149	0.135	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
11	PDB:7w59R	0.048	0.169	4.095	280	0.035	0.146	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:6zwmG	0.027	0.174	4.712	98	0.008	0.092	6zwmG.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
13	PDB:6f40W	0.050	0.196	5.055	218	0.025	0.133	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
14	PDB:5gmkc	0.030	0.071	7.183	436	0.031	0.083	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
15	PDB:7nvr1	0.024	0.080	8.868	265	0.015	0.064	7nvr1.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V672	0.0	1995	1162	0.857	0.854	G3V672_RAT Nuclear receptor interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Nrip1 PE=4 SV=1
2	P48552	0.0	2380	1158	1.000	1.000	NRIP1_HUMAN Nuclear receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=NRIP1 PE=1 SV=2
3	Q8CBD1	0.0	1979	1161	0.846	0.844	NRIP1_MOUSE Nuclear receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Nrip1 PE=1 SV=1
4	Q6DYE4	0.80	36.2	455	0.020	0.051	Y1609_ARATH Uncharacterized protein At1g26090, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g26090 PE=1 SV=1
5	O07742	3.8	33.1	203	0.016	0.094	O07742_MYCTU Lipid/polyisoprenoid-binding YceI-like domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1890c PE=1 SV=1
6	A0A075BR52	4.5	33.9	631	0.015	0.027	A0A075BR52_DANRE Draculin-like 3 OS=Danio rerio OX=7955 GN=drl-L3 PE=2 SV=1
7	B0R156	4.6	33.9	631	0.015	0.027	B0R156_DANRE Draculin-like, tandem duplicate 3 OS=Danio rerio OX=7955 GN=drl-L3 PE=4 SV=1
8	Q9Y228	7.2	33.1	551	0.018	0.038	T3JAM_HUMAN TRAF3-interacting JNK-activating modulator OS=Homo sapiens OX=9606 GN=TRAF3IP3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04452 Methyltrans_RNA	93	14.0	RNA methyltransferase domain
2	PF15687 NRIP1_repr_1	1.9e-145	495.9	Nuclear receptor-interacting protein 1 repression 1
3	PF15688 NRIP1_repr_2	1.4e-120	414.6	Nuclear receptor-interacting protein 1 repression 2
4	PF15689 NRIP1_repr_3	1.4e-41	152.0	Nuclear receptor-interacting protein 1 repression 3
5	PF15690 NRIP1_repr_4	1.9e-135	462.7	Nuclear receptor-interacting protein 1 repression 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.999	Estrogen receptor
2	9606.ENSP00000264867	0.996	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
3	9606.ENSP00000362649	0.992	Histone deacetylase 1
4	9606.ENSP00000254066	0.991	Retinoic acid receptor alpha
5	9606.ENSP00000385523	0.986	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000477707	0.981	Oxysterols receptor LXR-alpha
7	9606.ENSP00000261523	0.976	Nuclear receptor ROR-alpha
8	9606.ENSP00000290921	0.976	C-terminal-binding protein 1
9	9606.ENSP00000302967	0.972	Histone deacetylase 3
10	9606.ENSP00000419692	0.970	Retinoic acid receptor RXR-alpha
11	9606.ENSP00000333275	0.969	Nuclear receptor subfamily 2 group C member 1
12	9606.ENSP00000385216	0.966	Nuclear receptor coactivator 1
13	9606.ENSP00000384018	0.964	Nuclear receptor corepressor 2
14	9606.ENSP00000363817	0.958	Retinoic acid receptor RXR-beta
15	9606.ENSP00000300651	0.957	Mediator of RNA polymerase II transcription subunit 1
16	9606.ENSP00000262367	0.951	CREB-binding protein
17	9606.ENSP00000332296	0.946	Retinoic acid receptor beta
18	9606.ENSP00000263253	0.945	Histone acetyltransferase p300
19	9606.ENSP00000384863	0.945	Exportin-1
20	9606.ENSP00000451828	0.936	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0003713	1.000	transcription coactivator activity
GO:0030331	1.000	nuclear estrogen receptor binding
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000978	0.991	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0035259	0.985	nuclear glucocorticoid receptor binding
GO:0019899	0.486	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0009987	0.982	cellular process
GO:0048519	0.979	negative regulation of biological process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0048518	0.973	positive regulation of biological process
GO:0006357	0.963	regulation of transcription by RNA polymerase II
GO:0048523	0.949	negative regulation of cellular process
GO:0050896	0.946	response to stimulus
GO:0048522	0.946	positive regulation of cellular process
GO:0051173	0.946	positive regulation of nitrogen compound metabolic process
GO:0010604	0.946	positive regulation of macromolecule metabolic process
GO:0031325	0.937	positive regulation of cellular metabolic process
GO:0010557	0.933	positive regulation of macromolecule biosynthetic process
GO:0031328	0.932	positive regulation of cellular biosynthetic process
GO:0045935	0.932	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.923	cellular response to stimulus
GO:0045893	0.913	positive regulation of DNA-templated transcription
GO:0000122	0.912	negative regulation of transcription by RNA polymerase II
GO:0045944	0.904	positive regulation of transcription by RNA polymerase II
GO:0042221	0.886	response to chemical
GO:0010033	0.880	response to organic substance
GO:0070887	0.861	cellular response to chemical stimulus
GO:0071310	0.682	cellular response to organic substance
GO:0007623	0.675	circadian rhythm
GO:1901700	0.662	response to oxygen-containing compound
GO:0032922	0.582	circadian regulation of gene expression
GO:1901701	0.456	cellular response to oxygen-containing compound
GO:0033993	0.364	response to lipid
GO:0008152	0.362	metabolic process
GO:0071704	0.349	organic substance metabolic process
GO:0071407	0.329	cellular response to organic cyclic compound
GO:0071396	0.323	cellular response to lipid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0032991	0.986	protein-containing complex
GO:0005829	0.982	cytosol
GO:0005694	0.923	chromosome
GO:0140513	0.871	nuclear protein-containing complex
GO:0000785	0.744	chromatin
GO:0005730	0.722	nucleolus
GO:0016604	0.607	nuclear body
GO:1902494	0.541	catalytic complex
GO:0001650	0.440	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]