StarFunc result for job id P48553

User Input

>input (1259 residues)
MDASEEPLPPVIYTMENKPIVTCAGDQNLFTSVYPTLSQQLPREPMEWRRSYGRAPKMIH
LESNFVQFKEELLPKEGNKALLTFPFLHIYWTECCDTEVYKATVKDDLTKWQNVLKAHSS
VDWLIVIVENDAKKKNKTNILPRTSIVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWN
AFLTKLRTLLLMSFTKNLGKFEDDMRTLREKRTEPGWSFCEYFMVQEELAFVFEMLQQFE
DALVQYDELDALFSQYVVNFGAGDGANWLTFFCQPVKSWNGLILRKPIDMEKRESIQRRE
ATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHNCVQELKLLEVSVPPGALDCWVFL
SCLEVLQRIEGCCDRAQIDSNIAHTVGLWSYATEKLKSLGYLCGLVSEKGPNSEDLNRTV
DLLAGLGAERPETANTAQSPYKKLKEALSSVEAFEKHYLDLSHATIEMYTSIGRIRSAKF
VGKDLAEFYMRKKAPQKAEIYLQGALKNYLAEGWALPITHTRKQLAECQKHLGQIENYLQ
TSSLLASDHHLTEEERKHFCQEILDFASQPSDSPGHKIVLPMHSFAQLRDLHFDPSNAVV
HVGGVLCVEITMYSQMPVPVHVEQIVVNVHFSIEKNSYRKTAEWLTKHKTSNGIINFPPE
TAPFPVSQNSLPALELYEMFERSPSDNSLNTTGIICRNVHMLLRRQESSSSLEMPSGVAL
EEGAHVLRCSHVTLEPGANQITFRTQAKEPGTYTLRQLCASVGSVWFVLPHIYPIVQYDV
YSQEPQLHVEPLADSLLAGIPQRVKFTVTTGHYTIKNGDSLQLSNAEAMLILCQAESRAV
VYSNTREQSSEAALRIQSSDKVTSISLPVAPAYHVIEFELEVLSLPSAPALGGESDMLGM
AEPHRKHKDKQRTGRCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTTHSLLSSGTRKYV
QVCVQNLSELDFQLSDSYLVDTGDSTDLQLVPLNTQSQQPIYSKQSVFFVWELKWTEEPP
PSLHCRFSVGFSPASEEQLSISLKPYTYEFKVENFFTLYNVKAEIFPPSGMEYCRTGSLC
SLEVLITRLSDLLEVDKDEALTESDEHFSTKLMYEVVDNSSNWAVCGKSCGVISMPVAAR
ATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPD
SSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVSVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48553	1.000	1.000	0.000	1259	1.000	1.000	P48553.pdb.gz	TPC10_HUMAN Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2
2	AFDB:Q9VFB7	0.510	0.555	5.493E-80	1145	0.274	0.301	Q9VFB7.pdb.gz	TPC10_DROME Trafficking protein particle complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=SIDL PE=1 SV=1
3	AFDB:F4K0C4	0.406	0.406	4.406E-48	1259	0.184	0.184	F4K0C4.pdb.gz	TR130_ARATH Trafficking protein particle complex II-specific subunit 130 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS130 PE=1 SV=1
4	AFDB:Q03660	0.264	0.295	9.323E-34	1102	0.126	0.144	Q03660.pdb.gz	TR130_YEAST Trafficking protein particle complex II-specific subunit 130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRS130 PE=1 SV=1
5	AFDB:O74501	0.366	0.395	7.161E-32	1150	0.132	0.144	O74501.pdb.gz	YCRE_SCHPO Uncharacterized protein CC285.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC285.14 PE=3 SV=1
6	AFDB:Q8IRE3	0.268	0.258	4.207E-27	1320	0.132	0.126	Q8IRE3.pdb.gz	Q8IRE3_DROME Trafficking protein particle complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=gry PE=1 SV=2
7	AFDB:Q9VIL0	0.161	0.155	1.608E-21	1320	0.111	0.106	Q9VIL0.pdb.gz	BRUN_DROME Protein brunelleschi OS=Drosophila melanogaster OX=7227 GN=brun PE=1 SV=2
8	AFDB:Q9FY61	0.170	0.178	1.464E-19	1186	0.114	0.121	Q9FY61.pdb.gz	TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS120 PE=1 SV=1
9	PDB:7u05B	0.175	0.253	1.884E-18	815	0.080	0.124	7u05B.pdb.gz
10	PDB:7u05A	0.138	0.153	5.413E-16	1114	0.107	0.121	7u05A.pdb.gz
11	PDB:7sqcO0	0.102	0.111	1.892E-9	1140	0.077	0.085	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4lnvA	0.079	0.078	8.684E-7	1276	0.056	0.056	4lnvA.pdb.gz
13	PDB:4rtdA	0.098	0.107	2.123E-6	1122	0.046	0.052	4rtdA.pdb.gz
14	PDB:3fcsA	0.100	0.129	2.215E-6	913	0.042	0.058	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
15	PDB:7ea3J	0.124	0.164	4.020E-6	883	0.093	0.133	7ea3J.pdb.gz
16	PDB:7nxdA	0.099	0.129	5.189E-6	905	0.040	0.055	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:4g1eA	0.069	0.085	6.152E-6	964	0.041	0.053	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
18	PDB:7uslA	0.089	0.122	6.152E-6	856	0.040	0.058	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
19	AFDB:Q63041	0.105	0.092	7.606E-6	1500	0.056	0.047	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
20	AFDB:Q8IZJ3	0.099	0.074	1.116E-5	1885	0.059	0.039	Q8IZJ3.pdb.gz	CPMD8_HUMAN C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CPAMD8 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48553	0.0	2619	1259	1.000	1.000	TPC10_HUMAN Trafficking protein particle complex subunit 10 OS=Homo sapiens OX=9606 GN=TRAPPC10 PE=1 SV=2
2	Q9VFB7	2.86e-155	498	1145	0.290	0.319	TPC10_DROME Trafficking protein particle complex subunit 10 OS=Drosophila melanogaster OX=7227 GN=SIDL PE=1 SV=1
3	F4K0C4	3.48e-25	116	1259	0.073	0.073	TR130_ARATH Trafficking protein particle complex II-specific subunit 130 homolog OS=Arabidopsis thaliana OX=3702 GN=TRS130 PE=1 SV=1
4	Q5BEJ2	2.28e-24	113	1433	0.075	0.066	Q5BEJ2_EMENI TMEM1 family protein, putative (AFU_orthologue AFUA_1G12540) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01038 PE=4 SV=1
5	O74501	4.52e-13	76.6	1150	0.052	0.057	YCRE_SCHPO Uncharacterized protein CC285.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC285.14 PE=3 SV=1
6	Q03660	1.90e-04	48.5	1102	0.041	0.047	TR130_YEAST Trafficking protein particle complex II-specific subunit 130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRS130 PE=1 SV=1
7	Q9HZE5	0.96	36.2	1193	0.030	0.032	Q9HZE5_PSEAE PelB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pelB PE=1 SV=1
8	Q5DM57	1.9	35.4	1755	0.018	0.013	IF172_CHLRE Intraflagellar transport protein 172 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT172 PE=1 SV=1
9	O04678	2.1	35.0	745	0.017	0.030	O04678_SOLLC Subtilisin-like protease OS=Solanum lycopersicum OX=4081 GN=P69B PE=2 SV=1
10	F4JXM9	2.8	34.7	1190	0.017	0.018	F4JXM9_ARATH Trafficking protein particle complex subunit-like protein OS=Arabidopsis thaliana OX=3702 GN=ROG2 PE=1 SV=1
11	Q966M4	4.6	33.9	446	0.017	0.049	Q966M4_CAEEL Unconventional prefoldin RPB5 interactor OS=Caenorhabditis elegans OX=6239 GN=uri-1 PE=1 SV=1
12	Q6MG49	6.4	33.5	1146	0.021	0.023	BAG6_RAT Large proline-rich protein BAG6 OS=Rattus norvegicus OX=10116 GN=Bag6 PE=1 SV=2
13	Q9Z1R2	6.4	33.5	1154	0.021	0.023	BAG6_MOUSE Large proline-rich protein BAG6 OS=Mus musculus OX=10090 GN=Bag6 PE=1 SV=1
14	Q69Z28	6.5	33.5	1222	0.015	0.016	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
15	A0A1U9X7A6	6.8	33.5	1126	0.021	0.023	A0A1U9X7A6_HUMAN Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 PE=4 SV=1
16	A5D9M6	6.8	33.5	1128	0.025	0.027	BAG6_PIG Large proline-rich protein BAG6 OS=Sus scrofa OX=9823 GN=BAG6 PE=1 SV=1
17	P46379	7.3	33.5	1132	0.021	0.023	BAG6_HUMAN Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2
18	G1SU30	7.4	33.5	1162	0.021	0.022	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11817 Foie-gras_1	4	18.5	Foie gras liver health family 1
2	PF14938 SNAP	2.5e+02	12.5	Soluble NSF attachment protein, SNAP
3	PF12584 TRAPPC10	4.4e-24	96.4	Trafficking protein particle complex subunit 10, TRAPPC10

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291574

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373979	0.999	Trafficking protein particle complex subunit 9
2	9606.ENSP00000302783	0.998	Trafficking protein particle complex subunit 1
3	9606.ENSP00000392495	0.998	Trafficking protein particle complex subunit 2
4	9606.ENSP00000470262	0.998	Trafficking protein particle complex subunit 5
5	9606.ENSP00000480332	0.997	Trafficking protein particle complex subunit 3
6	9606.ENSP00000436005	0.995	Trafficking protein particle complex subunit 4
7	9606.ENSP00000283351	0.994	Trafficking protein particle complex subunit 8
8	9606.ENSP00000301021	0.991	Trafficking protein particle complex subunit 2-like protein
9	9606.ENSP00000357591	0.990	Trafficking protein particle complex subunit 3-like protein
10	9606.ENSP00000006275	0.988	Trafficking protein particle complex subunit 6A
11	9606.ENSP00000330289	0.981	Trafficking protein particle complex subunit 6B
12	9606.ENSP00000324318	0.979	Trafficking protein particle complex subunit 12
13	9606.ENSP00000469888	0.976	Trafficking protein particle complex 2 pseudogene 1
14	9606.ENSP00000335371	0.960	Trafficking protein particle complex subunit 11
15	9606.ENSP00000409231	0.947	Belongs to the TRAPPC13 family
16	9606.ENSP00000387286	0.921	Ras-related protein Rab-1A
17	9606.ENSP00000394071	0.910	Rab GDP dissociation inhibitor alpha
18	9606.ENSP00000291576	0.909	Periodic tryptophan protein 2 homolog
19	9606.ENSP00000350386	0.906	Rab proteins geranylgeranyltransferase component A 1
20	9606.ENSP00000369538	0.904	Rab GDP dissociation inhibitor beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.917	cellular process
GO:0051179	0.890	localization
GO:0006810	0.848	transport
GO:0071840	0.711	cellular component organization or biogenesis
GO:0016043	0.667	cellular component organization
GO:0048193	0.638	Golgi vesicle transport
GO:0065007	0.599	biological regulation
GO:0006996	0.515	organelle organization
GO:0050789	0.488	regulation of biological process
GO:0050794	0.453	regulation of cellular process
GO:0010256	0.308	endomembrane system organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030008	0.999	TRAPP complex
GO:0005829	0.999	cytosol
GO:0012505	0.968	endomembrane system
GO:0043226	0.955	organelle
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0031982	0.848	vesicle
GO:0016020	0.570	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]