StarFunc result for job id P48594

User Input

>input (390 residues)
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
EEFCCNHPFLFFIRQNKTNSILFYGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29508	0.985	0.985	3.518E-78	390	0.918	0.918	P29508.pdb.gz	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
2	PDB:2zv6B	0.911	0.957	2.965E-66	371	0.869	0.914	2zv6B.pdb.gz
3	AFDB:A2RSF9	0.941	0.951	9.923E-60	386	0.567	0.573	A2RSF9.pdb.gz	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
4	AFDB:Q6UKZ2	0.905	0.912	9.923E-60	387	0.582	0.587	Q6UKZ2.pdb.gz	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
5	AFDB:A0A0A0MQW3	0.893	0.872	2.914E-59	400	0.585	0.570	A0A0A0MQW3.pdb.gz	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
6	AFDB:O73790	0.902	0.859	8.862E-54	410	0.454	0.432	O73790.pdb.gz	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
7	AFDB:P01014	0.936	0.940	1.347E-53	388	0.444	0.446	P01014.pdb.gz	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
8	AFDB:R9TNA6	0.948	0.920	2.174E-53	402	0.426	0.413	R9TNA6.pdb.gz	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
9	AFDB:Q8VHP7	0.928	0.947	2.602E-53	382	0.479	0.490	Q8VHP7.pdb.gz	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
10	AFDB:P48595	0.921	0.905	3.509E-53	397	0.454	0.446	P48595.pdb.gz	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
11	AFDB:P30740	0.928	0.955	1.874E-52	379	0.490	0.504	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
12	PDB:4ga7A	0.903	0.953	5.488E-50	369	0.469	0.496	4ga7A.pdb.gz
13	PDB:2h4rA	0.873	0.917	3.732E-47	371	0.438	0.461	2h4rA.pdb.gz
14	PDB:1xqgA	0.886	0.913	1.003E-45	378	0.338	0.349	1xqgA.pdb.gz
15	PDB:2arqA	0.844	0.911	3.748E-43	360	0.403	0.436	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
16	PDB:2ol2A	0.858	0.926	6.625E-42	360	0.308	0.333	2ol2A.pdb.gz
17	PDB:1jmoA	0.868	0.796	6.834E-41	427	0.279	0.255	1jmoA.pdb.gz
18	PDB:4x30A	0.850	0.889	4.923E-40	372	0.321	0.336	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution
19	PDB:1yxaA	0.851	0.891	1.208E-39	372	0.333	0.349	1yxaA.pdb.gz
20	PDB:1hp7A	0.861	0.891	5.723E-39	376	0.331	0.343	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29508	0.0	699	390	0.918	0.918	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
2	P48594	0.0	810	390	1.000	1.000	SPB4_HUMAN Serpin B4 OS=Homo sapiens OX=9606 GN=SERPINB4 PE=1 SV=2
3	Q9UIV8	3.48e-163	464	391	0.585	0.583	SPB13_HUMAN Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2
4	A0A0A0MQW3	2.15e-162	463	400	0.587	0.573	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
5	Q9D1Q5	7.00e-160	456	387	0.592	0.597	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
6	Q8BHL1	1.31e-157	450	387	0.585	0.589	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
7	Q6UKZ2	9.56e-157	448	387	0.582	0.587	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
8	A2RSF9	3.27e-151	434	386	0.572	0.578	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
9	Q6UKZ1	4.80e-149	429	386	0.564	0.570	Q6UKZ1_MOUSE Serpinb3c OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
10	Q9D1E7	2.91e-148	426	386	0.567	0.573	Q9D1E7_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
11	Q9D154	1.01e-114	341	379	0.477	0.491	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
12	A0A024QZT4	1.19e-114	341	376	0.462	0.479	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
13	P50453	1.19e-114	341	376	0.462	0.479	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
14	O73790	2.66e-114	341	410	0.454	0.432	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
15	P30740	2.57e-113	337	379	0.477	0.491	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
16	V9HWH1	2.57e-113	337	379	0.477	0.491	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
17	P01014	8.68e-113	336	388	0.454	0.456	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
18	R9TNA6	9.22e-113	337	402	0.433	0.420	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
19	P35237	1.07e-112	336	376	0.467	0.484	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
20	Q8VHP7	1.92e-112	335	382	0.479	0.490	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	1.2e-132	454.4	Serpin (serine protease inhibitor)
2	PF03401 TctC	2.3e+02	12.2	Tripartite tricarboxylate transporter family receptor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343445

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283752	0.989	Serpin B3
2	9606.ENSP00000216336	0.958	Cathepsin G
3	9606.ENSP00000458537	0.684	Chymotrypsin-like protease CTRL-1
4	9606.ENSP00000308938	0.652	Plasminogen
5	9606.ENSP00000250378	0.548	Chymase
6	9606.ENSP00000230431	0.543	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
7	9606.ENSP00000299727	0.527	Galanin receptor type 1
8	9606.ENSP00000357712	0.519	S100 calcium binding protein A7
9	9606.ENSP00000357718	0.515	Protein S100-A7A
10	9606.ENSP00000260113	0.501	Peptidase inhibitor 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0002020	0.999	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0065009	0.985	regulation of molecular function
GO:0051246	0.985	regulation of protein metabolic process
GO:0045861	0.983	negative regulation of proteolysis
GO:0052547	0.981	regulation of peptidase activity
GO:0048585	0.980	negative regulation of response to stimulus
GO:0043086	0.980	negative regulation of catalytic activity
GO:0010466	0.972	negative regulation of peptidase activity
GO:0080134	0.935	regulation of response to stress
GO:0048523	0.909	negative regulation of cellular process
GO:0009987	0.906	cellular process
GO:0002683	0.852	negative regulation of immune system process
GO:0032102	0.783	negative regulation of response to external stimulus
GO:0031341	0.781	regulation of cell killing
GO:0050896	0.761	response to stimulus
GO:0031348	0.757	negative regulation of defense response
GO:0052548	0.719	regulation of endopeptidase activity
GO:0002697	0.707	regulation of immune effector process
GO:0045824	0.700	negative regulation of innate immune response
GO:0001910	0.691	regulation of leukocyte mediated cytotoxicity
GO:0002706	0.634	regulation of lymphocyte mediated immunity
GO:0031342	0.620	negative regulation of cell killing
GO:0042269	0.565	regulation of natural killer cell mediated cytotoxicity
GO:0048518	0.473	positive regulation of biological process
GO:0002704	0.462	negative regulation of leukocyte mediated immunity
GO:0043405	0.368	regulation of MAP kinase activity
GO:0048522	0.310	positive regulation of cellular process
GO:0043409	0.301	negative regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0043226	0.997	organelle
GO:0005737	0.997	cytoplasm
GO:0005829	0.992	cytosol
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0031982	0.991	vesicle
GO:0005634	0.967	nucleus
GO:0030141	0.958	secretory granule
GO:0016020	0.951	membrane
GO:0071944	0.943	cell periphery
GO:0005773	0.940	vacuole
GO:0031974	0.926	membrane-enclosed lumen
GO:0005764	0.926	lysosome
GO:0070013	0.916	intracellular organelle lumen
GO:0005615	0.893	extracellular space
GO:0005775	0.893	vacuolar lumen
GO:0043230	0.851	extracellular organelle
GO:0070062	0.776	extracellular exosome
GO:0031981	0.731	nuclear lumen
GO:0005654	0.724	nucleoplasm
GO:0005886	0.618	plasma membrane
GO:0031012	0.418	extracellular matrix
GO:0035578	0.321	azurophil granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]