StarFunc result for job id P48595

User Input

>input (397 residues)
MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQF
NRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTY
AFHNKYLEDMKTYFGAEPQPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTR
MILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQ
LYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSY
DLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSEID
IRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48595	1.000	1.000	2.148E-86	397	1.000	1.000	P48595.pdb.gz	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
2	AFDB:Q8K3K4	0.953	0.953	9.125E-67	397	0.713	0.713	Q8K3K4.pdb.gz	SPB10_RAT Serpin B10 OS=Rattus norvegicus OX=10116 GN=Serpinb10 PE=2 SV=1
3	AFDB:O73790	0.907	0.879	3.336E-54	410	0.491	0.476	O73790.pdb.gz	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
4	AFDB:Q9D154	0.913	0.956	1.380E-53	379	0.466	0.488	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
5	AFDB:A0A0A0MQW3	0.917	0.911	2.807E-53	400	0.446	0.443	A0A0A0MQW3.pdb.gz	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
6	AFDB:Q8VHP7	0.915	0.950	3.352E-53	382	0.461	0.479	Q8VHP7.pdb.gz	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
7	AFDB:P29508	0.912	0.928	1.386E-52	390	0.451	0.459	P29508.pdb.gz	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
8	AFDB:Q6UKZ2	0.902	0.925	1.863E-52	387	0.458	0.470	Q6UKZ2.pdb.gz	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
9	AFDB:P30740	0.915	0.958	6.847E-52	379	0.448	0.470	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
10	AFDB:P05120	0.912	0.874	7.707E-52	415	0.471	0.451	P05120.pdb.gz	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
11	PDB:2h4rA	0.883	0.944	3.558E-50	371	0.474	0.507	2h4rA.pdb.gz
12	PDB:4ga7A	0.889	0.956	1.561E-49	369	0.438	0.472	4ga7A.pdb.gz
13	PDB:2zv6B	0.879	0.940	2.394E-46	371	0.448	0.480	2zv6B.pdb.gz
14	PDB:2arqA	0.841	0.925	2.277E-44	360	0.456	0.503	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
15	PDB:1xqgA	0.869	0.912	5.236E-43	378	0.355	0.373	1xqgA.pdb.gz
16	PDB:2ol2A	0.839	0.922	1.942E-40	360	0.325	0.358	2ol2A.pdb.gz
17	PDB:1hp7A	0.846	0.891	3.524E-39	376	0.315	0.332	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
18	PDB:4x30A	0.851	0.906	2.340E-38	372	0.300	0.320	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution
19	PDB:1yxaA	0.846	0.901	1.027E-37	372	0.302	0.323	1yxaA.pdb.gz
20	PDB:1jmoA	0.850	0.792	6.816E-37	427	0.272	0.253	1jmoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48595	0.0	825	397	1.000	1.000	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
2	Q8K3K4	0.0	587	397	0.713	0.713	SPB10_RAT Serpin B10 OS=Rattus norvegicus OX=10116 GN=Serpinb10 PE=2 SV=1
3	O73790	2.43e-131	385	410	0.491	0.476	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
4	P05120	7.05e-125	369	415	0.476	0.455	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
5	Q9D154	2.02e-122	361	379	0.469	0.491	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
6	Q9D1Q5	3.35e-119	353	387	0.453	0.465	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
7	A0A024QZT4	2.24e-118	350	376	0.446	0.471	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
8	P50453	2.24e-118	350	376	0.446	0.471	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
9	Q8BHL1	2.25e-117	348	387	0.458	0.470	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
10	Q9UIV8	4.98e-117	347	391	0.451	0.458	SPB13_HUMAN Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2
11	A0A0A0MQW3	1.08e-116	347	400	0.446	0.443	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
12	Q6UKZ2	1.59e-116	346	387	0.456	0.468	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
13	A2RSF9	3.73e-115	343	386	0.443	0.456	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
14	P12388	1.25e-113	340	415	0.469	0.448	PAI2_MOUSE Plasminogen activator inhibitor 2, macrophage OS=Mus musculus OX=10090 GN=Serpinb2 PE=1 SV=1
15	P29524	3.14e-113	339	416	0.456	0.435	PAI2_RAT Plasminogen activator inhibitor 2 type A OS=Rattus norvegicus OX=10116 GN=Serpinb2 PE=2 SV=1
16	Q8VHP7	3.62e-113	337	382	0.458	0.476	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
17	Q5SV42	3.11e-112	335	375	0.446	0.472	ILEUC_MOUSE Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1
18	Q9D1E7	4.40e-112	335	386	0.438	0.451	Q9D1E7_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
19	Q6UKZ1	2.73e-111	333	386	0.436	0.448	Q6UKZ1_MOUSE Serpinb3c OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
20	P30740	1.47e-110	330	379	0.448	0.470	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	7.1e-128	438.6	Serpin (serine protease inhibitor)
2	PF18588 WcbI	78	14.3	Polysaccharide biosynthesis enzyme WcbI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216336	0.831	Cathepsin G
2	9606.ENSP00000260113	0.566	Peptidase inhibitor 15
3	9606.ENSP00000327533	0.528	Lysozyme g-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005488	0.996	binding
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.966	biological regulation
GO:0050789	0.962	regulation of biological process
GO:0009987	0.889	cellular process
GO:0050896	0.532	response to stimulus
GO:0048519	0.492	negative regulation of biological process
GO:0050794	0.353	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043226	0.996	organelle
GO:0005829	0.991	cytosol
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0016020	0.989	membrane
GO:0005886	0.975	plasma membrane
GO:0005634	0.967	nucleus
GO:0012505	0.961	endomembrane system
GO:0031982	0.947	vesicle
GO:0070013	0.944	intracellular organelle lumen
GO:0005576	0.930	extracellular region
GO:0030141	0.914	secretory granule
GO:0031090	0.807	organelle membrane
GO:0031981	0.761	nuclear lumen
GO:0005654	0.745	nucleoplasm
GO:0070820	0.701	tertiary granule
GO:0005615	0.663	extracellular space
GO:0098588	0.657	bounding membrane of organelle
GO:0101002	0.607	ficolin-1-rich granule
GO:0030667	0.605	secretory granule membrane
GO:0031012	0.366	extracellular matrix
GO:0062023	0.353	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]