StarFunc result for job id P48634

User Input

>input (2157 residues)
MSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPA
NLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPPESQPLPASQTPASN
QPKRPPAAPENTPLVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGP
PQFPPYRGMMPPFMYPPYLPFPPPYGPQGPYRYPTPDGPSRFPRVAGPRGSGPPMRLVEP
VGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHRD
SQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPA
GNWGPPGDYPDRGGPPCKPPAPEDEDEAWRQRRKQSSSEISLAVERARRRREEEERRMQE
ERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPAPPPAVPKELPAPPAPPPASAP
TPETEPEEPAQAPPAQSTPTPGVAAAPTLVSGGGSTSSTSSGSFEASPVEPQLPSKEGPE
PPEEVPPPTTPPVPKVEPKGDGIGPTRQPPSQGLGYPKYQKSLPPRFQRQQQEQLLKQQQ
QHQWQQHQQGSAPPTPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNFD
PRWMMIPPYVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFDRHAPAMLRER
GTPPVDPKLAWVGDVFTATPAEPRPLTSPLRQAADEDDKGMRSETPPVPPPPPYLASYPG
FPENGAPGPPISRFPLEEPGPRPLPWPPGSDEVAKIQTPPPKKEPPKEETAQLTGPEAGR
KPARGVGSGGQGPPPPRRESRTETRWGPRPGSSRRGIPPEEPGAPPRRAGPIKKPPPPTK
VEELPPKPLEQGDETPKPPKPDPLKITKGKLGGPKETPPNGNLSPAPRLRRDYSYERVGP
TSCRGRGRGEYFARGRGFRGTYGGRGRGARSREFRSYREFRGDDGRGGGTGGPNHPPAPR
GRTASETRSEGSEYEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPP
PPGAPPSPAPARFTARGGRVFTPRGVPSRRGRGGGRPPPQVCPGWSPPAKSLAPKKPPTG
PLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGERPRRRRHGRAQQQDKPPRFRRL
KQERENAARGSEGKPSLTLPASAPGPEEALTTVTVAPAPRRAAAKSPDLSNQNSDQANEE
WETASESSDFTSERRGDKEAPPPVLLTPKAVGTPGGGGGGAVPGISAMSRGDLSQRAKDL
SKRSFSSQRPGMERQNRRPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRS
RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHK
PGLPQAPQGPSPRPPTRYEPQRVNSGLSSDPHFEEPGPMVRGVGGTPRDSAGVSPFPPKR
RERPPRKPELLQEESLPPPHSSGFLGSKPEGPGPQAESRDTGTEALTPHIWNRLHTATSR
KSYRPSSMEPWMEPLSPFEDVAGTEMSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAA
EGPPKRPGGSSPLNAVPCEGPPGSEPPRRPPPAPHDGDRKELPREQPLPPGPIGTERSQR
TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWE
LLPSAAASAEPQSKNLDSGHCVPEPSSSGQRLYPEVFYGSAGPSSSQISGGAMDSQLHPN
SGGFRPGTPSLHPYRSQPLYLPPGPAPPSALLSGLALKGQFLDFSTMQATELGKLPAGGV
LYPPPSFLYSPAFCPSPLPDTSLLQVRQDLPSPSDFYSTPLQPGGQSGFLPSGAPAQQML
LPMVDSQLPVVNFGSLPPAPPPAPPPLSLLPVGPALQPPSLAVRPPPAPATRVLPSPARP
FPASLGRAELHPVELKPFQDYQKLSSNLGGPGSSRTPPTGRSFSGLNSRLKATPSTYSGV
FRTQRVDLYQQASPPDALRWIPKPWERTGPPPREGPSRRAEEPGSRGDKEPGLPPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48634	0.999	0.999	0.000	2157	1.000	1.000	P48634.pdb.gz	PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3
2	AFDB:Q5JSZ5	0.048	0.046	2.168E-40	2229	0.318	0.307	Q5JSZ5.pdb.gz	PRC2B_HUMAN Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2
3	AFDB:Q7TPM1	0.043	0.054	1.905E-26	1486	0.217	0.316	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
4	AFDB:Q9W2U7	0.038	0.036	1.708E-3	2309	0.168	0.157	Q9W2U7.pdb.gz	Q9W2U7_DROME LP18708p OS=Drosophila melanogaster OX=7227 GN=nocte PE=1 SV=4
5	AFDB:P18160	0.030	0.028	1.968E-2	2410	0.136	0.122	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
6	AFDB:Q54S20	0.033	0.029	3.810E-2	2678	0.118	0.095	Q54S20.pdb.gz	MED13_DICDI Mediator of RNA polymerase II transcription subunit 13 OS=Dictyostelium discoideum OX=44689 GN=amiB PE=2 SV=1
7	AFDB:Q14157	0.025	0.034	4.349E-2	1087	0.091	0.181	Q14157.pdb.gz	UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2
8	AFDB:Q6PRD1	0.025	0.024	4.646E-2	2367	0.154	0.141	Q6PRD1.pdb.gz	GP179_HUMAN Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2
9	AFDB:B1AV60	0.032	0.035	4.963E-2	1647	0.130	0.170	B1AV60.pdb.gz	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
10	AFDB:P49750	0.029	0.029	5.302E-2	2146	0.165	0.166	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X974	0.0	4142	2157	1.000	1.000	A0A1U9X974_HUMAN PRRC2A OS=Homo sapiens OX=9606 PE=4 SV=1
2	P48634	0.0	4142	2157	1.000	1.000	PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3
3	Q7TPM1	2.19e-101	362	1486	0.168	0.244	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
4	Q5JSZ5	2.38e-99	360	2229	0.162	0.157	PRC2B_HUMAN Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2
5	Q3TLH4	1.61e-89	329	2846	0.117	0.089	PRC2C_MOUSE Protein PRRC2C OS=Mus musculus OX=10090 GN=Prrc2c PE=1 SV=3
6	E7EPN9	8.97e-88	323	2819	0.116	0.089	E7EPN9_HUMAN Proline rich coiled-coil 2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=1
7	Q9Y520	1.84e-85	316	2896	0.115	0.086	PRC2C_HUMAN Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4
8	Q501B2	7.1	33.9	409	0.033	0.176	BZP16_ARATH bZIP transcription factor 16 OS=Arabidopsis thaliana OX=3702 GN=BZIP16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07001 BAT2_N	7.4e-67	237.0	BAT2 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365076	0.777	Uncharacterized protein C6orf47
2	9606.ENSP00000365131	0.759	Large proline-rich protein BAG6
3	9606.ENSP00000365318	0.741	NF-kappa-B inhibitor-like protein 1
4	9606.ENSP00000364543	0.710	Helicase SKI2W
5	9606.ENSP00000364815	0.704	Valine--tRNA ligase
6	9606.ENSP00000364677	0.703	Zinc finger and BTB domain-containing protein 12
7	9606.ENSP00000379282	0.699	Phosphatidylserine (PS) lipase that mediates the hydrolysis of phosphatidylserine to generate lysophosphatidylserine (LPS) (By similarity). LPS constitutes a class of signaling lipids that regulates immunological and neurological processes (By similarity). Has no activity towards diacylglycerol, triacylglycerol or lysophosphatidylserine lipase . Also has monoacylglycerol lipase activity, with preference for 1-(9Z,12Z- octadecadienoyl)-glycerol (1-LG) and 2-glyceryl-15-deoxy-Delta(12,14)- prostaglandin J2 (15d-PGJ(2)-G) .
8	9606.ENSP00000365071	0.675	G-patch domain and ankyrin repeats 1
9	9606.ENSP00000398837	0.671	Histone-lysine N-methyltransferase 2B
10	9606.ENSP00000323076	0.668	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
11	9606.ENSP00000230053	0.663	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
12	9606.ENSP00000458663	0.656	Protein capicua homolog
13	9606.ENSP00000262518	0.652	Helicase SRCAP
14	9606.ENSP00000358159	0.618	Activating signal cointegrator 1 complex subunit 3
15	9606.ENSP00000361926	0.618	Protein canopy homolog 3
16	9606.ENSP00000211413	0.612	Interferon induced transmembrane protein domain containing
17	9606.ENSP00000365362	0.604	Mitochondrial coiled-coil domain 1
18	9606.ENSP00000389445	0.599	Ubiquitin-associated protein 2-like
19	9606.ENSP00000367422	0.588	Leukemia-associated protein 1
20	9606.ENSP00000358549	0.587	Probable arginine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0065007	0.867	biological regulation
GO:0008152	0.832	metabolic process
GO:0050789	0.824	regulation of biological process
GO:0050794	0.751	regulation of cellular process
GO:0071704	0.645	organic substance metabolic process
GO:0044237	0.629	cellular metabolic process
GO:0044238	0.602	primary metabolic process
GO:0006807	0.571	nitrogen compound metabolic process
GO:0043170	0.537	macromolecule metabolic process
GO:0032502	0.348	developmental process
GO:0048856	0.318	anatomical structure development
GO:0019222	0.300	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005576	0.789	extracellular region
GO:0065010	0.720	extracellular membrane-bounded organelle
GO:0070062	0.708	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]