StarFunc result for job id P48668

User Input

>input (564 residues)
MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG
GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK
VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR
NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA
LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY
EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCASLQAAIADAEQRGEMAL
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG
VGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLS
SVGGGSSTIKYTTTSSSSRKSYKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02538	0.600	0.600	1.726E-65	564	0.984	0.984	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
2	AFDB:Q9Z331	0.659	0.661	5.008E-57	562	0.851	0.854	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
3	AFDB:P13647	0.535	0.515	1.148E-49	590	0.798	0.763	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
4	AFDB:Q922U2	0.337	0.330	6.004E-48	580	0.748	0.728	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
5	AFDB:O95678	0.594	0.608	7.054E-47	551	0.715	0.731	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
6	AFDB:Q8BGZ7	0.364	0.370	8.824E-47	551	0.736	0.753	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
7	AFDB:Q6PVZ5	0.347	0.329	2.267E-42	599	0.718	0.676	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
8	AFDB:A0A1D5PXP0	0.351	0.377	1.833E-41	522	0.674	0.728	A0A1D5PXP0.pdb.gz
9	AFDB:H2EQW7	0.243	0.271	2.973E-38	499	0.642	0.725	H2EQW7.pdb.gz	H2EQW7_CHICK Keratin 75 OS=Gallus gallus OX=9031 GN=KRT75 PE=2 SV=1
10	AFDB:P07744	0.373	0.399	1.922E-37	525	0.612	0.657	P07744.pdb.gz	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
11	PDB:5lj5O	0.094	0.160	4.432	283	0.034	0.067	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7mqaNA	0.060	0.095	6.438	295	0.032	0.061	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	H2EQW7	603	499	0.598	0.675	H2EQW7_CHICK Keratin 75 OS=Gallus gallus OX=9031 GN=KRT75 PE=2 SV=1
2	O95678	735	551	0.706	0.722	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
3	P02538	1121	564	0.984	0.984	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
4	P04259	1125	564	0.988	0.988	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
5	P04264	569	644	0.477	0.418	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
6	P07744	590	525	0.551	0.592	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
7	P12035	564	628	0.491	0.441	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
8	P13647	717	590	0.702	0.671	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	P19013	585	520	0.573	0.621	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
10	P48668	1132	564	1.000	1.000	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
11	P50446	778	553	0.809	0.825	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
12	Q01546	555	638	0.484	0.428	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
13	Q0IIN1	530	578	0.480	0.469	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
14	Q14CN4	573	511	0.539	0.595	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
15	Q29426	575	629	0.507	0.455	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
16	Q3SY84	566	523	0.548	0.591	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
17	Q3UV17	560	594	0.486	0.461	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
18	Q5XKE5	602	535	0.562	0.593	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
19	Q6IFZ5	543	581	0.473	0.460	Q6IFZ5_RAT Keratin 76 OS=Rattus norvegicus OX=10116 GN=Krt76 PE=2 SV=1
20	Q6P6Q2	700	576	0.691	0.677	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	5.8e+02	12.4	Apg6 coiled-coil region
2	PF08614 ATG16	11	17.6	Autophagy protein 16 (ATG16)
3	PF10473 CENP-F_leu_zip	0.0041	28.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
4	PF14362 DUF4407	6.2e+02	11.1	Domain of unknown function (DUF4407)
5	PF05335 DUF745	2.8e+02	12.6	Protein of unknown function (DUF745)
6	PF03961 FapA	26	16.0	Flagellar Assembly Protein A beta solenoid domain
7	PF00038 Filament	7.8e-113	388.8	Intermediate filament protein
8	PF09744 Jnk-SapK_ap_N	32	16.3	JNK_SAPK-associated protein-1
9	PF16208 Keratin_2_head	6.7e-35	132.0	Keratin type II head
10	PF03938 OmpH	1.9e+02	13.7	Outer membrane protein (OmpH-like)
11	PF07926 TPR_MLP1_2	0.00078	30.9	TPR/MLP1/MLP2-like protein
12	PF12718 Tropomyosin_1	27	16.4	Tropomyosin like
13	PF03670 UPF0184	65	15.3	Uncharacterised protein family (UPF0184)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252250

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306461	0.674	Cornifin-B
2	9606.ENSP00000369317	0.667	Keratin, type II cytoskeletal 6A
3	9606.ENSP00000360200	0.663	InaD-like protein
4	9606.ENSP00000252252	0.655	Keratin, type II cytoskeletal 6B
5	9606.ENSP00000261681	0.629	MAGUK p55 subfamily member 5
6	9606.ENSP00000373487	0.590	Keratin, type I cytoskeletal 18
7	9606.ENSP00000252245	0.580	Keratin, type II cytoskeletal 75
8	9606.ENSP00000252242	0.524	Keratin, type II cytoskeletal 5
9	9606.ENSP00000307240	0.522	Keratin, type II cytoskeletal 74
10	9606.ENSP00000369349	0.522	Keratin, type II cuticular Hb1
11	9606.ENSP00000257951	0.521	Keratin, type II cuticular Hb4
12	9606.ENSP00000257974	0.520	Keratin, type II cuticular Hb2
13	9606.ENSP00000301653	0.513	Keratin, type I cytoskeletal 16
14	9606.ENSP00000267119	0.510	Keratin, type II cytoskeletal 71
15	9606.ENSP00000293745	0.509	Keratin, type II cytoskeletal 72
16	9606.ENSP00000257901	0.508	Keratin, type II cuticular Hb5
17	9606.ENSP00000375430	0.507	Keratin-associated protein 3-1
18	9606.ENSP00000307014	0.505	Keratin, type II cytoskeletal 73
19	9606.ENSP00000293670	0.502	Keratin, type II cuticular Hb3
20	9606.ENSP00000444533	0.501	Keratin, type II cuticular Hb6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.966	structural molecule activity
GO:0005200	0.310	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0032502	0.989	developmental process
GO:0045103	0.977	intermediate filament-based process
GO:0048856	0.972	anatomical structure development
GO:0016043	0.860	cellular component organization
GO:0045104	0.852	intermediate filament cytoskeleton organization
GO:0009888	0.715	tissue development
GO:0065007	0.561	biological regulation
GO:0008544	0.544	epidermis development
GO:0050789	0.518	regulation of biological process
GO:0050794	0.447	regulation of cellular process
GO:0050896	0.335	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0005615	0.998	extracellular space
GO:0070062	0.992	extracellular exosome
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005634	0.917	nucleus
GO:0016020	0.899	membrane
GO:0099513	0.846	polymeric cytoskeletal fiber
GO:0045095	0.829	keratin filament
GO:0005886	0.314	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]