StarFunc result for job id P48681

User Input

>input (1621 residues)
MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRAHADDEL
AALRALVDQRWREKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEK
CARAWLSSQVAELERELEALRVAHEEERVGLNAQAACAPRCPAPPRGPPAPAPEVEELAR
RLGEAWRGAVRGYQERVAHMETSLGQARERLGRAVQGAREGRLELQQLQAERGGLLERRA
ALEQRLEGRWQERLRATEKFQLAVEALEQEKQGLQSQIAQVLEGRQQLAHLKMSLSLEVA
TYRTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPRTPEGRRLGSLLPVLSPTSLPSPL
PATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGG
RKQAPEPLRAEARVAIPASVLPGPEEPGGQRQEASTGQSPEDHASLAPPLSPDHSSLEAK
DGESGGSRVFSICRGEGEGQIWGLVEKETAIEGKVVSSLQQEIWEEEDLNRKEIQDSQVP
LEKETLKSLGEEIQESLKTLENQSHETLERENQECPRSLEEDLETLKSLEKENKELLKDV
EVVRPLEKEAVGQLKPTGKEDTQTLQSLQKENQELMKSLEGNLETFLFPGTENQELVSSL
QENLESLTALEKENQEPLRSPEVGDEEALRPLTKENQEPLRSLEDENKEAFRSLEKENQE
PLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLGEQDQMTLRPP
EKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETL
KSPETQAPLWTPEEINQGAMNPLEKEIQEPLESVEVNQETFRLLEEENQESLRSLGAWNL
ENLRSPEEVDKESQRNLEEEENLGKGEYQESLRSLEEEGQELPQSADVQRWEDTVEKDQE
LAQESPPGMAGVENEDEAELNLREQDGFTGKEEVVEQGELNATEEVWIPGEGHPESPEPK
EQRGLVEGASVKGGAEGLQDPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASP
EVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGP
RKDLEEAGGLGTEFSELPGKSRDPWEPPREGREESEAEAPRGAEEAFPAETLGHTGSDAP
SPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEGSQEASWGVQGRAEALGKVE
SEQEELGSGEIPEGPQEEGEESREESEEDELGETLPDSTPLGFYLRSPTSPRWDPTGEQR
PPPQGETGKEGWDPAVLASEGLEAPPSEKEEGEEGEEECGRDSDLSEEFEDLGTEAPFLP
GVPGEVAEPLGQVPQLLLDPAAWDRDGESDGFADEEESGEEGEEDQEEGREPGAGRWGPG
SSVGSLQALSSSQRGEFLESDSVSVSVPWDDSLRGAVAGAPKTALETESQDSAEPSGSEE
ESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGPNLEGKSQHVNGGVMNGLEQS
EEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQREGDRESWSSGE
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48681	1.000	1.000	0.000	1621	1.000	1.000	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
2	AFDB:Q6P5H2	0.148	0.132	7.207E-95	1864	0.569	0.495	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
3	AFDB:Q9Z1Q1	0.093	0.084	1.379E-63	1818	0.468	0.417	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
4	AFDB:Q70IV5	0.101	0.104	2.744E-23	1561	0.182	0.189	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
5	AFDB:G3V9G5	0.098	0.102	4.393E-22	1557	0.180	0.188	G3V9G5.pdb.gz	G3V9G5_RAT Synemin OS=Rattus norvegicus OX=10116 GN=Synm PE=1 SV=2
6	AFDB:O15061	0.140	0.144	1.537E-20	1565	0.188	0.194	O15061.pdb.gz	SYNEM_HUMAN Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=3
7	AFDB:P86839	0.163	0.203	1.048E-19	1265	0.162	0.207	P86839.pdb.gz	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
8	AFDB:O94964	0.052	0.058	3.290E-14	1423	0.145	0.165	O94964.pdb.gz	SOGA1_HUMAN Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1 PE=1 SV=2
9	AFDB:Q1G7G9	0.033	0.035	7.723E-14	1523	0.136	0.144	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
10	AFDB:P35658	0.034	0.029	1.072E-12	2090	0.139	0.108	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
11	PDB:3jb9g	0.022	0.194	4.211	148	0.009	0.101	3jb9g.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:3k2sA	0.038	0.173	7.437	243	0.035	0.230	3k2sA.pdb.gz	Double superhelix model of high density lipoprotein.
13	PDB:7a5fA	0.041	0.201	9.206	162	0.016	0.160	7a5fA.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21263	0.0	880	1893	0.357	0.306	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
2	P48681	0.0	3130	1621	1.000	1.000	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
3	Q6P5H2	0.0	601	1864	0.329	0.286	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
4	Q9Z1Q1	0.0	613	1818	0.280	0.250	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
5	P86839	2.24e-41	169	1265	0.065	0.083	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
6	A0A060XL43	4.52e-23	106	449	0.059	0.214	A0A060XL43_ONCMY IF rod domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00043362001 PE=3 SV=1
7	P48674	6.51e-23	106	461	0.059	0.206	VIME_ONCMY Vimentin OS=Oncorhynchus mykiss OX=8022 GN=vim PE=2 SV=1
8	P31000	2.10e-21	102	466	0.066	0.230	VIME_RAT Vimentin OS=Rattus norvegicus OX=10116 GN=Vim PE=1 SV=2
9	P08670	2.16e-21	102	466	0.068	0.238	VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4
10	V9HWE1	2.16e-21	102	466	0.068	0.238	V9HWE1_HUMAN Epididymis luminal protein 113 OS=Homo sapiens OX=9606 GN=HEL113 PE=2 SV=1
11	P02544	2.22e-21	101	465	0.066	0.230	VIME_MESAU Vimentin OS=Mesocricetus auratus OX=10036 GN=VIM PE=1 SV=2
12	P20152	2.80e-21	101	466	0.066	0.230	VIME_MOUSE Vimentin OS=Mus musculus OX=10090 GN=Vim PE=1 SV=3
13	P48670	3.03e-21	101	448	0.066	0.239	VIME_CRIGR Vimentin (Fragment) OS=Cricetulus griseus OX=10029 GN=VIM PE=2 SV=1
14	Q9YHX5	3.22e-21	101	455	0.059	0.211	Q9YHX5_DANRE Vimentin OS=Danio rerio OX=7955 GN=cb28 PE=1 SV=1
15	P02543	3.67e-21	101	466	0.068	0.238	VIME_PIG Vimentin OS=Sus scrofa OX=9823 GN=VIM PE=1 SV=2
16	P48616	6.07e-21	100	466	0.065	0.227	VIME_BOVIN Vimentin OS=Bos taurus OX=9913 GN=VIM PE=1 SV=3
17	A0A1W2PR46	7.29e-20	97.4	505	0.062	0.200	A0A1W2PR46_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1
18	P14136	1.01e-19	96.3	432	0.062	0.234	GFAP_HUMAN Glial fibrillary acidic protein OS=Homo sapiens OX=9606 GN=GFAP PE=1 SV=1
19	Q58EE9	3.35e-19	94.7	444	0.062	0.225	GFAP_DANRE Glial fibrillary acidic protein OS=Danio rerio OX=7955 GN=gfap PE=1 SV=2
20	P09654	4.40e-19	94.7	460	0.066	0.233	VIME_CHICK Vimentin OS=Gallus gallus OX=9031 GN=VIM PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	9.9e-23	92.8	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357206

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419782	0.994	Cyclin-dependent-like kinase 5
2	9606.ENSP00000323588	0.900	Transcription factor SOX-2
3	9606.ENSP00000337697	0.884	Neuronal migration protein doublecortin
4	9606.ENSP00000404100	0.872	Paired box protein Pax-6
5	9606.ENSP00000264498	0.868	Fibroblast growth factor 2
6	9606.ENSP00000463653	0.865	RNA binding protein fox-1 homolog 3
7	9606.ENSP00000426809	0.864	Prominin-1
8	9606.ENSP00000259915	0.857	POU domain, class 5, transcription factor 1
9	9606.ENSP00000229307	0.837	Homeobox protein NANOG
10	9606.ENSP00000353508	0.834	Microtubule-associated protein 2
11	9606.ENSP00000451560	0.834	Uncharacterized protein
12	9606.ENSP00000320295	0.828	Tubulin beta-3 chain
13	9606.ENSP00000330218	0.826	Transcription factor SOX-1
14	9606.ENSP00000331040	0.825	Oligodendrocyte transcription factor 2
15	9606.ENSP00000265171	0.824	Pro-epidermal growth factor
16	9606.ENSP00000241651	0.821	Myogenin
17	9606.ENSP00000446007	0.813	Vimentin
18	9606.ENSP00000359567	0.772	Transcription factor SOX-3
19	9606.ENSP00000291700	0.768	Protein S100-B
20	9606.ENSP00000284240	0.742	Thy-1 membrane glycoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.991	cellular process
GO:0050789	0.919	regulation of biological process
GO:0050794	0.914	regulation of cellular process
GO:0065009	0.832	regulation of molecular function
GO:0048856	0.818	anatomical structure development
GO:0050896	0.764	response to stimulus
GO:0050790	0.758	regulation of catalytic activity
GO:0032501	0.717	multicellular organismal process
GO:0048518	0.699	positive regulation of biological process
GO:0048522	0.683	positive regulation of cellular process
GO:0048519	0.607	negative regulation of biological process
GO:0007275	0.546	multicellular organism development
GO:0019222	0.525	regulation of metabolic process
GO:0048523	0.443	negative regulation of cellular process
GO:0051716	0.360	cellular response to stimulus
GO:0048731	0.352	system development
GO:0044092	0.351	negative regulation of molecular function
GO:0060255	0.351	regulation of macromolecule metabolic process
GO:0042127	0.319	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045111	1.000	intermediate filament cytoskeleton
GO:0005737	0.999	cytoplasm
GO:0043227	0.797	membrane-bounded organelle
GO:0043231	0.747	intracellular membrane-bounded organelle
GO:0070013	0.525	intracellular organelle lumen
GO:0005634	0.376	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]