StarFunc result for job id P48728

User Input

>input (403 residues)
MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQ
YRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFT
NEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
ALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGA
VHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM
DFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNV
AMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2U7	0.942	0.942	2.132E-91	403	1.000	1.000	A0A024R2U7.pdb.gz
2	AFDB:Q8CFA2	0.968	0.968	4.850E-85	403	0.888	0.888	Q8CFA2.pdb.gz	GCST_MOUSE Aminomethyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Amt PE=1 SV=1
3	AFDB:P25285	0.942	0.956	3.608E-84	397	0.873	0.887	P25285.pdb.gz	GCST_BOVIN Aminomethyltransferase, mitochondrial OS=Bos taurus OX=9913 GN=AMT PE=1 SV=1
4	PDB:1wsvA	0.916	0.995	5.689E-81	371	0.921	1.000	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
5	AFDB:A0A1B0GTV8	0.664	0.762	2.360E-68	351	0.868	0.997	A0A1B0GTV8.pdb.gz	A0A1B0GTV8_HUMAN Aminomethyltransferase OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
6	AFDB:P28337	0.924	0.949	4.793E-68	392	0.643	0.661	P28337.pdb.gz	GCST_CHICK Aminomethyltransferase, mitochondrial OS=Gallus gallus OX=9031 GN=AMT PE=1 SV=2
7	AFDB:O65396	0.933	0.922	2.488E-59	408	0.481	0.475	O65396.pdb.gz	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
8	AFDB:P49364	0.924	0.913	4.490E-59	408	0.501	0.495	P49364.pdb.gz	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
9	AFDB:O14110	0.897	0.934	6.010E-54	387	0.432	0.450	O14110.pdb.gz	GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv1 PE=3 SV=1
10	AFDB:P48015	0.887	0.893	6.745E-50	400	0.397	0.400	P48015.pdb.gz	GCST_YEAST Aminomethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCV1 PE=1 SV=2
11	AFDB:P27248	0.802	0.885	1.935E-37	364	0.283	0.313	P27248.pdb.gz	GCST_ECOLI Aminomethyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=gcvT PE=1 SV=3
12	PDB:1vloA	0.796	0.879	6.987E-37	364	0.278	0.308	1vloA.pdb.gz
13	PDB:4pabB	0.822	0.410	7.857E-36	824	0.236	0.115	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
14	PDB:1nrkA	0.605	0.733	3.199E-17	325	0.132	0.163	1nrkA.pdb.gz
15	PDB:6qe4A	0.551	0.699	6.876E-14	308	0.127	0.166	6qe4A.pdb.gz	In-house high-energy-remote SAD phasing using the magic triangle: how to tackle the P1 low symmetry using multiple orientations of the same crystal of human IBA57 to increase the multiplicity.
16	PDB:7c79B	0.626	0.339	1.170E-13	793	0.169	0.086	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
17	PDB:6ahrB	0.594	0.330	1.236E-7	774	0.156	0.081	6ahrB.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
18	PDB:7o4iO	0.153	0.253	4.012E-3	181	0.050	0.110	7o4iO.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:1vokA	0.156	0.253	4.256E-3	192	0.042	0.089	1vokA.pdb.gz
20	PDB:5gv2C	0.192	0.239	4.256E-3	307	0.065	0.085	5gv2C.pdb.gz	Structural mechanism for the arginine sensing and regulation of CASTOR1 in the mTORC1 signaling pathway

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GTB6	0.0	648	321	0.784	0.984	A0A1B0GTB6_HUMAN Aminomethyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
2	A0A1B0GTV8	0.0	701	351	0.871	1.000	A0A1B0GTV8_HUMAN Aminomethyltransferase OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
3	A0A1B0GVP5	0.0	719	351	0.871	1.000	A0A1B0GVP5_HUMAN Aminomethyltransferase OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
4	B3KTU4	0.0	732	355	0.881	1.000	B3KTU4_HUMAN Aminomethyltransferase OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
5	H0Y695	0.0	680	338	0.821	0.979	H0Y695_HUMAN Aminomethyltransferase OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=2
6	P25285	0.0	703	397	0.873	0.887	GCST_BOVIN Aminomethyltransferase, mitochondrial OS=Bos taurus OX=9913 GN=AMT PE=1 SV=1
7	P28337	0.0	516	392	0.640	0.658	GCST_CHICK Aminomethyltransferase, mitochondrial OS=Gallus gallus OX=9031 GN=AMT PE=1 SV=2
8	P48728	0.0	831	403	1.000	1.000	GCST_HUMAN Aminomethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
9	Q8CFA2	0.0	742	403	0.888	0.888	GCST_MOUSE Aminomethyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Amt PE=1 SV=1
10	A0A1B0GUU7	2.42e-133	384	242	0.457	0.760	A0A1B0GUU7_HUMAN Aminomethyltransferase OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1
11	P49364	2.28e-132	387	408	0.494	0.488	GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum OX=3888 GN=GDCST PE=1 SV=2
12	O65396	1.39e-131	385	408	0.496	0.490	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
13	O14110	2.30e-111	333	387	0.434	0.452	GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcv1 PE=3 SV=1
14	P48015	1.28e-86	270	400	0.402	0.405	GCST_YEAST Aminomethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCV1 PE=1 SV=2
15	P27248	2.04e-46	165	364	0.293	0.324	GCST_ECOLI Aminomethyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=gcvT PE=1 SV=3
16	P9WN51	2.66e-32	127	367	0.266	0.292	GCST_MYCTU Aminomethyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gcvT PE=1 SV=1
17	Q9UI17	3.44e-20	95.1	866	0.251	0.117	M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DMGDH PE=1 SV=2
18	Q5LS57	1.76e-19	91.3	364	0.246	0.272	DMDA_RUEPO Dimethylsulfonioproprionate demethylase DmdA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=dmdA PE=1 SV=1
19	Q63342	5.13e-18	88.6	857	0.243	0.114	M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dmgdh PE=1 SV=1
20	Q9DBT9	4.25e-17	85.9	869	0.246	0.114	M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dmgdh PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01571 GCV_T	2.6e-78	274.4	Aminomethyltransferase folate-binding domain
2	PF08669 GCV_T_C	4.2e-16	69.9	Glycine cleavage T-protein C-terminal barrel domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319531	0.999	Glycine cleavage system H protein, mitochondrial
2	9606.ENSP00000370737	0.999	Glycine dehydrogenase (decarboxylating), mitochondrial
3	9606.ENSP00000318868	0.996	Serine hydroxymethyltransferase, cytosolic
4	9606.ENSP00000333667	0.996	Serine hydroxymethyltransferase, mitochondrial
5	9606.ENSP00000205402	0.989	Dihydrolipoyl dehydrogenase, mitochondrial
6	9606.ENSP00000377617	0.980	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
7	9606.ENSP00000236959	0.979	Bifunctional purine biosynthesis protein PURH
8	9606.ENSP00000379108	0.979	Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
9	9606.ENSP00000216605	0.974	C-1-tetrahydrofolate synthase, cytoplasmic
10	9606.ENSP00000365777	0.974	Methylenetetrahydrofolate reductase
11	9606.ENSP00000478253	0.972	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
12	9606.ENSP00000302620	0.971	Alanine-glyoxylate aminotransferase
13	9606.ENSP00000371253	0.965	Trifunctional purine biosynthetic protein adenosine-3
14	9606.ENSP00000315644	0.960	Thymidylate synthase
15	9606.ENSP00000396308	0.956	Dihydrofolate reductase
16	9606.ENSP00000377768	0.955	Dihydrofolate reductase 2, mitochondrial
17	9606.ENSP00000355536	0.945	Methionine synthase
18	9606.ENSP00000291670	0.942	Formimidoyltransferase-cyclodeaminase
19	9606.ENSP00000220058	0.939	Methionyl-tRNA formyltransferase, mitochondrial
20	9606.ENSP00000273450	0.917	Cytosolic 10-formyltetrahydrofolate dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016742	1.000	hydroxymethyl-, formyl- and related transferase activity
GO:0005488	0.999	binding
GO:0097159	0.959	organic cyclic compound binding
GO:1901363	0.957	heterocyclic compound binding
GO:0004047	0.563	aminomethyltransferase activity
GO:0043167	0.546	ion binding
GO:0005515	0.526	protein binding
GO:0036094	0.444	small molecule binding
GO:0043168	0.369	anion binding
GO:0016491	0.361	oxidoreductase activity
GO:0003676	0.359	nucleic acid binding
GO:0031406	0.337	carboxylic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009071	0.995	serine family amino acid catabolic process
GO:0006544	0.937	glycine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0005739	1.000	mitochondrion
GO:0031981	0.990	nuclear lumen
GO:0005654	0.975	nucleoplasm
GO:0005759	0.948	mitochondrial matrix
GO:0005829	0.412	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.2.-	1.000	Hydroxymethyl-, formyl- and related transferases.
RHEA:16945	0.563	(6S)-5,6,7,8-tetrahydrofolate + (R)-N(6)-(S(8)-aminomethyldihydrolipoyl)-L-lysyl-[protein] = (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + (R)-N(6)-dihydrolipoyl-L-lysyl-[protein] + NH4(+)
EC:2.1.2.10	0.563	aminomethyltransferase.
EC:1.-.-.-	0.361	Oxidoreductases.

[back to server]