StarFunc result for job id P48735

User Input

>input (452 residues)
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48735	1.000	1.000	9.122E-91	452	1.000	1.000	P48735.pdb.gz	IDHP_HUMAN Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2
2	PDB:6adiA	0.848	0.914	1.038E-77	418	0.909	0.983	6adiA.pdb.gz	Crystal structures of pan-IDH inhibitor AG-881 in complex with mutant human IDH1 and IDH2
3	AFDB:Q8LPJ5	0.899	0.838	9.319E-68	485	0.624	0.581	Q8LPJ5.pdb.gz	ICDHP_ARATH Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g14590 PE=1 SV=1
4	AFDB:B7Z0E0	0.900	0.850	1.726E-66	479	0.600	0.566	B7Z0E0.pdb.gz	B7Z0E0_DROME Isocitrate dehydrogenase [NADP] OS=Drosophila melanogaster OX=7227 GN=Idh PE=1 SV=2
5	AFDB:Q6R6M7	0.891	0.977	3.163E-66	412	0.622	0.682	Q6R6M7.pdb.gz	Q6R6M7_PEA Isocitrate dehydrogenase [NADP] OS=Pisum sativum OX=3888 PE=2 SV=1
6	AFDB:B0UXL2	0.901	0.949	1.843E-65	429	0.619	0.653	B0UXL2.pdb.gz
7	AFDB:O75874	0.899	0.981	3.378E-65	414	0.628	0.686	O75874.pdb.gz	IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2
8	AFDB:Q9SLK0	0.889	0.965	8.614E-65	416	0.619	0.673	Q9SLK0.pdb.gz	ICDHX_ARATH Peroxisomal isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana OX=3702 GN=ICDH PE=1 SV=1
9	AFDB:C8VIX5	0.887	0.814	1.074E-64	493	0.626	0.574	C8VIX5.pdb.gz	C8VIX5_EMENI Isocitrate dehydrogenase [NADP] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02999 PE=3 SV=1
10	AFDB:Q75JR3	0.895	0.981	1.074E-64	412	0.564	0.619	Q75JR3.pdb.gz	IDHC_DICDI Isocitrate dehydrogenase [NADP] cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=idhC PE=1 SV=1
11	AFDB:Q9SRZ6	0.885	0.975	1.074E-64	410	0.626	0.690	Q9SRZ6.pdb.gz	ICDHC_ARATH Cytosolic isocitrate dehydrogenase [NADP] OS=Arabidopsis thaliana OX=3702 GN=CICDH PE=1 SV=1
12	PDB:5yfnA	0.883	0.953	2.131E-61	418	0.628	0.679	5yfnA.pdb.gz	Human isocitrate dehydrogenase 1 bound with isocitrate
13	PDB:4hcxA	0.825	0.922	5.492E-60	402	0.588	0.662	4hcxA.pdb.gz	Structural, Kinetic and Chemical Mechanism of Isocitrate Dehydrogenase-1 from Mycobacterium tuberculosis.
14	PDB:2qfwD	0.884	0.969	3.855E-57	412	0.564	0.619	2qfwD.pdb.gz
15	PDB:3marA	0.796	0.910	1.412E-53	393	0.588	0.677	3marA.pdb.gz	Molecular mechanisms of "off-on switch" of activities of human IDH1 by tumor-associated mutation R132H.
16	PDB:6aj6A	0.808	0.879	3.845E-52	413	0.564	0.617	6aj6A.pdb.gz	Biochemical characterization of a novel Trypanosoma brucei glycosomal isocitrate dehydrogenase with dual coenzyme specificity (NADP+/NAD+)
17	PDB:5l58A	0.770	0.920	1.442E-51	376	0.575	0.691	5l58A.pdb.gz	Discovery and Optimization of Allosteric Inhibitors of Mutant Isocitrate Dehydrogenase 1 (R132H IDH1) Displaying Activity in Human Acute Myeloid Leukemia Cells.
18	PDB:6adgC	0.798	0.919	2.671E-50	390	0.584	0.677	6adgC.pdb.gz	Crystal structures of pan-IDH inhibitor AG-881 in complex with mutant human IDH1 and IDH2
19	PDB:4i3kA	0.757	0.924	6.101E-50	367	0.555	0.684	4i3kA.pdb.gz	Crystallographic Investigation and Selective Inhibition of Mutant Isocitrate Dehydrogenase.
20	PDB:1hqsA	0.635	0.676	5.868E-17	423	0.186	0.199	1hqsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B7Z0E0	568	479	0.586	0.553	B7Z0E0_DROME Isocitrate dehydrogenase [NADP] OS=Drosophila melanogaster OX=7227 GN=Idh PE=1 SV=2
2	C8VIX5	563	493	0.595	0.546	C8VIX5_EMENI Isocitrate dehydrogenase [NADP] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02999 PE=3 SV=1
3	O14254	561	439	0.582	0.599	IDHP_SCHPO Probable isocitrate dehydrogenase [NADP], mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idp1 PE=3 SV=2
4	O75874	600	414	0.624	0.681	IDHC_HUMAN Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2
5	O88844	598	414	0.624	0.681	IDHC_MOUSE Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mus musculus OX=10090 GN=Idh1 PE=1 SV=2
6	P21954	531	428	0.571	0.603	IDHP_YEAST Isocitrate dehydrogenase [NADP], mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDP1 PE=1 SV=1
7	P41562	604	414	0.628	0.686	IDHC_RAT Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rattus norvegicus OX=10116 GN=Idh1 PE=1 SV=1
8	P41939	545	412	0.575	0.631	IDHC_YEAST Isocitrate dehydrogenase [NADP] cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDP2 PE=1 SV=2
9	P48735	948	452	1.000	1.000	IDHP_HUMAN Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2
10	P53982	531	420	0.560	0.602	IDHH_YEAST Isocitrate dehydrogenase [NADP] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDP3 PE=3 SV=1
11	P54071	909	452	0.951	0.951	IDHP_MOUSE Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3
12	P56574	905	452	0.947	0.947	IDHP_RAT Isocitrate dehydrogenase [NADP], mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh2 PE=1 SV=2
13	P9WKL1	560	409	0.588	0.650	IDH_MYCTU Isocitrate dehydrogenase [NADP] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=icd PE=1 SV=1
14	Q13584	790	419	0.830	0.895	Q13584_HUMAN Isocitrate dehydrogenase [NADP] OS=Homo sapiens OX=9606 PE=2 SV=1
15	Q387G0	559	413	0.564	0.617	Q387G0_TRYB2 Isocitrate dehydrogenase [NADP] OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0230 PE=1 SV=1
16	Q6FXL1	536	411	0.566	0.623	Q6FXL1_CANGA Isocitrate dehydrogenase [NADP] OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IDP2 PE=3 SV=1
17	Q6R6M7	597	412	0.624	0.684	Q6R6M7_PEA Isocitrate dehydrogenase [NADP] OS=Pisum sativum OX=3888 PE=2 SV=1
18	Q75JR3	550	412	0.564	0.619	IDHC_DICDI Isocitrate dehydrogenase [NADP] cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=idhC PE=1 SV=1
19	Q7KUB0	565	416	0.586	0.637	Q7KUB0_DROME Isocitrate dehydrogenase [NADP] OS=Drosophila melanogaster OX=7227 GN=Idh PE=1 SV=1
20	Q7KUB1	568	469	0.586	0.565	Q7KUB1_DROME Isocitrate dehydrogenase [NADP] OS=Drosophila melanogaster OX=7227 GN=Idh PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00180 Iso_dh	5.1e-76	267.8	Isocitrate/isopropylmalate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331897

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299518	0.998	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
2	9606.ENSP00000217901	0.997	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
3	9606.ENSP00000370223	0.996	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
4	9606.ENSP00000216254	0.982	Aconitate hydratase, mitochondrial
5	9606.ENSP00000222673	0.974	2-oxoglutarate dehydrogenase, mitochondrial
6	9606.ENSP00000372191	0.963	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
7	9606.ENSP00000245206	0.962	Aspartate aminotransferase, mitochondrial
8	9606.ENSP00000363216	0.960	2-oxoglutarate dehydrogenase-like, mitochondrial
9	9606.ENSP00000309477	0.957	Cytoplasmic aconitate hydratase
10	9606.ENSP00000315351	0.946	D-2-hydroxyglutarate dehydrogenase, mitochondrial
11	9606.ENSP00000390265	0.936	Isocitrate dehydrogenase 1, cytosolic
12	9606.ENSP00000277865	0.930	Glutamate dehydrogenase 1, mitochondrial
13	9606.ENSP00000327070	0.920	Malate dehydrogenase, mitochondrial
14	9606.ENSP00000327589	0.905	Glutamate dehydrogenase 2, mitochondrial
15	9606.ENSP00000345282	0.896	Alanine aminotransferase 2
16	9606.ENSP00000359539	0.895	Aspartate aminotransferase, cytoplasmic
17	9606.ENSP00000442788	0.870	Methylcytosine dioxygenase TET2
18	9606.ENSP00000378408	0.864	Alanine aminotransferase 1
19	9606.ENSP00000303077	0.856	Putative aspartate aminotransferase, cytoplasmic 2
20	9606.ENSP00000485525	0.849	Adenylosuccinate lyase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004450	1.000	isocitrate dehydrogenase (NADP+) activity
GO:0005488	0.966	binding
GO:0005515	0.942	protein binding
GO:0043167	0.306	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0044281	0.884	small molecule metabolic process
GO:0006807	0.725	nitrogen compound metabolic process
GO:0065007	0.656	biological regulation
GO:0050789	0.603	regulation of biological process
GO:1901564	0.523	organonitrogen compound metabolic process
GO:0050794	0.513	regulation of cellular process
GO:0034641	0.371	cellular nitrogen compound metabolic process
GO:1901360	0.340	organic cyclic compound metabolic process
GO:0046483	0.340	heterocycle metabolic process
GO:0050896	0.326	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.933	intracellular organelle lumen
GO:0005829	0.854	cytosol
GO:0005634	0.735	nucleus
GO:0005759	0.496	mitochondrial matrix
GO:0070062	0.349	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19629	1.000	D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH
EC:1.1.1.42	1.000	isocitrate dehydrogenase (NADP(+)).

[back to server]