StarFunc result for job id P48736

User Input

>input (1102 residues)
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mezA	0.865	0.961	0.000	989	0.896	0.998	7mezA.pdb.gz
2	AFDB:A0A024R720	0.952	0.952	0.000	1102	1.000	1.000	A0A024R720.pdb.gz
3	AFDB:F1QVE6	0.954	0.958	0.000	1098	0.711	0.713	F1QVE6.pdb.gz
4	AFDB:P42338	0.762	0.784	1.537E-70	1070	0.309	0.319	P42338.pdb.gz	PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
5	AFDB:O00329	0.737	0.776	1.670E-70	1044	0.309	0.326	O00329.pdb.gz	PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens OX=9606 GN=PIK3CD PE=1 SV=2
6	AFDB:F1NHX1	0.760	0.799	2.342E-69	1046	0.308	0.324	F1NHX1.pdb.gz	F1NHX1_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CD PE=3 SV=1
7	AFDB:F1RB17	0.741	0.784	1.087E-67	1039	0.292	0.310	F1RB17.pdb.gz
8	AFDB:F1QAD7	0.735	0.757	7.875E-67	1069	0.317	0.326	F1QAD7.pdb.gz	F1QAD7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=pik3ca PE=3 SV=2
9	AFDB:P54673	0.765	0.544	2.606E-66	1571	0.305	0.214	P54673.pdb.gz	PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum OX=44689 GN=pikA PE=2 SV=2
10	AFDB:P91634	0.756	0.766	6.198E-66	1088	0.294	0.298	P91634.pdb.gz	P91634_DROME PI-3 kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K92E PE=1 SV=1
11	AFDB:P54674	0.735	0.443	3.149E-63	1857	0.306	0.181	P54674.pdb.gz	PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum OX=44689 GN=pikB PE=2 SV=2
12	PDB:6pyuA	0.693	0.816	2.982E-62	930	0.288	0.341	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
13	PDB:5itdA	0.711	0.784	5.770E-62	995	0.314	0.348	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
14	PDB:4yknA	0.712	0.653	1.072E-61	1205	0.318	0.290	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
15	PDB:5dxhD	0.689	0.770	6.861E-61	981	0.309	0.348	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
16	PDB:7lq1A	0.705	0.813	7.452E-61	950	0.289	0.336	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
17	PDB:5swpA	0.712	0.739	2.466E-60	1060	0.307	0.319	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
18	PDB:5dxtA	0.702	0.873	2.444E-56	879	0.297	0.372	5dxtA.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
19	PDB:2y3aA	0.696	0.781	4.969E-55	976	0.301	0.340	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
20	PDB:8dcxA	0.677	0.796	3.316E-54	930	0.306	0.362	8dcxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AKZ7	0.0	1967	1024	0.860	0.926	A0A8I6AKZ7_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cg PE=3 SV=1
2	D3ZFJ0	0.0	2148	1102	0.936	0.936	D3ZFJ0_RAT phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Rattus norvegicus OX=10116 GN=Pik3cg PE=1 SV=1
3	P48736	0.0	2296	1102	1.000	1.000	PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens OX=9606 GN=PIK3CG PE=1 SV=3
4	Q6NTI2	0.0	1598	1098	0.716	0.719	Q6NTI2_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:77033 PE=2 SV=1
5	Q9JHG7	0.0	2161	1102	0.941	0.941	PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus OX=10090 GN=Pik3cg PE=1 SV=2
6	O42391	6.42e-176	546	1068	0.321	0.331	O42391_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CA PE=1 SV=1
7	P32871	1.50e-174	542	1068	0.325	0.335	PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus OX=9913 GN=PIK3CA PE=1 SV=1
8	P42336	1.78e-174	542	1068	0.325	0.335	PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PIK3CA PE=1 SV=2
9	P42337	2.56e-172	536	1068	0.323	0.333	PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Pik3ca PE=1 SV=2
10	A0A0G2K344	2.76e-172	536	1068	0.323	0.333	PK3CA_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Pik3ca PE=1 SV=1
11	F1QAD7	3.85e-171	533	1069	0.319	0.329	F1QAD7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=pik3ca PE=3 SV=2
12	Q8BTI9	2.80e-164	515	1064	0.309	0.320	PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus OX=10090 GN=Pik3cb PE=1 SV=2
13	Q9Z1L0	1.32e-161	508	1070	0.299	0.308	PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus OX=10116 GN=Pik3cb PE=2 SV=1
14	F1NHX1	1.97e-161	507	1046	0.299	0.315	F1NHX1_CHICK phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Gallus gallus OX=9031 GN=PIK3CD PE=3 SV=1
15	O35904	5.13e-160	503	1043	0.283	0.299	PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus OX=10090 GN=Pik3cd PE=1 SV=2
16	O00329	1.47e-159	502	1044	0.279	0.295	PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens OX=9606 GN=PIK3CD PE=1 SV=2
17	P42338	2.45e-159	503	1070	0.295	0.304	PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
18	H0Y871	8.36e-153	474	702	0.260	0.409	H0Y871_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 (Fragment) OS=Homo sapiens OX=9606 GN=PIK3CB PE=1 SV=1
19	P91634	5.08e-149	476	1088	0.280	0.284	P91634_DROME PI-3 kinase OS=Drosophila melanogaster OX=7227 GN=Pi3K92E PE=1 SV=1
20	Q7SYE7	6.25e-149	474	1039	0.271	0.288	Q7SYE7_DANRE phosphatidylinositol-4,5-bisphosphate 3-kinase OS=Danio rerio OX=7955 GN=zgc:63473 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11589 DUF3244	3.4e+02	12.8	Domain of unknown function (DUF3244)
2	PF13575 DUF4135	13	16.6	Domain of unknown function (DUF4135)
3	PF00613 PI3Ka	2.4e-61	217.9	Phosphoinositide 3-kinase family, accessory domain (PIK domain)
4	PF00792 PI3K_C2	9.3e-12	56.5	Phosphoinositide 3-kinase C2
5	PF00794 PI3K_rbd	1.3e-25	101.0	PI3-kinase family, ras-binding domain
6	PF00454 PI3_PI4_kinase	1.1e-56	204.1	Phosphatidylinositol 3- and 4-kinase
7	PF19710 PIK3CG_ABD	8.1e-93	320.9	PIK3 catalytic subunit gamma adaptor-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352121

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392812	0.999	Phosphoinositide 3-kinase regulatory subunit 5
2	9606.ENSP00000282096	0.998	cGMP-inhibited 3',5'-cyclic phosphodiesterase B
3	9606.ENSP00000407586	0.998	GTPase HRas
4	9606.ENSP00000428056	0.995	Phosphatidylinositol 3-kinase regulatory subunit alpha
5	9606.ENSP00000480157	0.993	Phosphoinositide 3-kinase regulatory subunit 6
6	9606.ENSP00000371067	0.990	Tyrosine-protein kinase JAK2
7	9606.ENSP00000256078	0.986	GTPase KRas
8	9606.ENSP00000451828	0.986	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000387262	0.977	MICOS complex subunit MIC60
10	9606.ENSP00000166244	0.971	Ephrin type-A receptor 8
11	9606.ENSP00000482548	0.970	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
12	9606.ENSP00000222254	0.967	Phosphatidylinositol 3-kinase regulatory subunit beta
13	9606.ENSP00000262741	0.966	Phosphatidylinositol 3-kinase regulatory subunit gamma
14	9606.ENSP00000364907	0.964	Tyrosine-protein kinase SYK
15	9606.ENSP00000358548	0.962	GTPase NRas
16	9606.ENSP00000386884	0.962	C-X-C chemokine receptor type 4
17	9606.ENSP00000405338	0.958	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
18	9606.ENSP00000355231	0.956	Beclin-1
19	9606.ENSP00000334448	0.951	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
20	9606.ENSP00000481878	0.950	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016303	1.000	1-phosphatidylinositol-3-kinase activity
GO:0016307	0.664	phosphatidylinositol phosphate kinase activity
GO:0140096	0.566	catalytic activity, acting on a protein
GO:0019899	0.417	enzyme binding
GO:0035005	0.386	1-phosphatidylinositol-4-phosphate 3-kinase activity
GO:0004672	0.356	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048583	0.992	regulation of response to stimulus
GO:0050896	0.991	response to stimulus
GO:0006661	0.989	phosphatidylinositol biosynthetic process
GO:0048518	0.987	positive regulation of biological process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0051716	0.982	cellular response to stimulus
GO:0046854	0.982	phosphatidylinositol phosphate biosynthetic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051056	0.974	regulation of small GTPase mediated signal transduction
GO:0007165	0.973	signal transduction
GO:0048519	0.964	negative regulation of biological process
GO:0046578	0.954	regulation of Ras protein signal transduction
GO:0051174	0.943	regulation of phosphorus metabolic process
GO:0048522	0.941	positive regulation of cellular process
GO:0009894	0.939	regulation of catabolic process
GO:0040012	0.936	regulation of locomotion
GO:0048584	0.931	positive regulation of response to stimulus
GO:0051179	0.921	localization
GO:0048523	0.920	negative regulation of cellular process
GO:0050727	0.915	regulation of inflammatory response
GO:0048017	0.914	inositol lipid-mediated signaling
GO:0060255	0.907	regulation of macromolecule metabolic process
GO:0002673	0.893	regulation of acute inflammatory response
GO:0042221	0.889	response to chemical
GO:0070887	0.882	cellular response to chemical stimulus
GO:0032501	0.868	multicellular organismal process
GO:0019216	0.863	regulation of lipid metabolic process
GO:0030334	0.856	regulation of cell migration
GO:0065009	0.853	regulation of molecular function
GO:0051247	0.839	positive regulation of protein metabolic process
GO:0030335	0.835	positive regulation of cell migration
GO:0065008	0.811	regulation of biological quality
GO:0050790	0.803	regulation of catalytic activity
GO:1902533	0.799	positive regulation of intracellular signal transduction
GO:0050994	0.794	regulation of lipid catabolic process
GO:0051239	0.789	regulation of multicellular organismal process
GO:0019220	0.787	regulation of phosphate metabolic process
GO:0001932	0.784	regulation of protein phosphorylation
GO:0010632	0.782	regulation of epithelial cell migration
GO:0043085	0.771	positive regulation of catalytic activity
GO:0010594	0.771	regulation of endothelial cell migration
GO:0051338	0.751	regulation of transferase activity
GO:0016477	0.723	cell migration
GO:0048015	0.721	phosphatidylinositol-mediated signaling
GO:0009892	0.716	negative regulation of metabolic process
GO:0010634	0.711	positive regulation of epithelial cell migration
GO:0009605	0.706	response to external stimulus
GO:0006950	0.703	response to stress
GO:0031325	0.689	positive regulation of cellular metabolic process
GO:0002376	0.680	immune system process
GO:0014065	0.679	phosphatidylinositol 3-kinase signaling
GO:0010595	0.675	positive regulation of endothelial cell migration
GO:0008219	0.646	cell death
GO:0012501	0.642	programmed cell death
GO:0048585	0.638	negative regulation of response to stimulus
GO:0016192	0.598	vesicle-mediated transport
GO:0010941	0.587	regulation of cell death
GO:0051896	0.572	regulation of protein kinase B signaling
GO:0051057	0.562	positive regulation of small GTPase mediated signal transduction
GO:0051641	0.541	cellular localization
GO:0046579	0.535	positive regulation of Ras protein signal transduction
GO:0001775	0.528	cell activation
GO:0006807	0.518	nitrogen compound metabolic process
GO:0035020	0.510	regulation of Rac protein signal transduction
GO:0050878	0.467	regulation of body fluid levels
GO:0010468	0.448	regulation of gene expression
GO:0043170	0.441	macromolecule metabolic process
GO:0007166	0.406	cell surface receptor signaling pathway
GO:0016310	0.390	phosphorylation
GO:0051640	0.386	organelle localization
GO:0051240	0.363	positive regulation of multicellular organismal process
GO:0043067	0.342	regulation of programmed cell death
GO:0071840	0.331	cellular component organization or biogenesis
GO:0051897	0.315	positive regulation of protein kinase B signaling
GO:0010033	0.309	response to organic substance
GO:0050900	0.309	leukocyte migration
GO:0006935	0.303	chemotaxis
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.997	plasma membrane
GO:0032991	0.974	protein-containing complex
GO:1902494	0.946	catalytic complex
GO:0098796	0.938	membrane protein complex
GO:0061695	0.938	transferase complex, transferring phosphorus-containing groups
GO:0005942	0.917	phosphatidylinositol 3-kinase complex
GO:0043227	0.807	membrane-bounded organelle
GO:0043231	0.789	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12709	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	1.000	phosphatidylinositol 3-kinase.
RHEA:18373	0.386	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + ADP + H(+)
EC:2.7.1.154	0.386	phosphatidylinositol-4-phosphate 3-kinase.

[back to server]