StarFunc result for job id P48739

User Input

>input (271 residues)
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHK
IYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLG
TLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKE
LANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTM
EDIRRMEDETQKELETMRKRGSVRGTSAADV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48739	1.000	1.000	7.262E-57	271	1.000	1.000	P48739.pdb.gz	PIPNB_HUMAN Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2
2	PDB:2a1lA	0.984	0.991	9.656E-51	269	0.970	0.978	2a1lA.pdb.gz
3	AFDB:F1QRW4	0.990	0.986	1.408E-50	272	0.845	0.842	F1QRW4.pdb.gz	F1QRW4_DANRE Phosphatidylinositol transfer protein beta isoform isoform 1 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=1
4	AFDB:Q802Z3	0.985	0.989	1.999E-49	270	0.768	0.770	Q802Z3.pdb.gz	Q802Z3_DANRE Phosphatidylinositol transfer protein, beta,-like OS=Danio rerio OX=7955 GN=zgc:55645 PE=1 SV=1
5	AFDB:P16446	0.990	0.990	1.266E-48	271	0.775	0.775	P16446.pdb.gz	PIPNA_RAT Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2
6	AFDB:Q803U3	0.986	0.986	1.797E-47	271	0.753	0.753	Q803U3.pdb.gz	Q803U3_DANRE Phosphatidylinositol transfer protein alpha isoform OS=Danio rerio OX=7955 GN=pitpna PE=1 SV=1
7	PDB:1uw5A	0.972	0.979	6.256E-45	269	0.768	0.773	1uw5A.pdb.gz	Structure-Function Analysis of Human [Corrected] Phosphatidylinositol Transfer Protein Alpha Bound to Phosphatidylinositol.
8	AFDB:A0A0B4KGG5	0.940	0.933	1.881E-37	273	0.627	0.623	A0A0B4KGG5.pdb.gz	A0A0B4KGG5_DROME Vibrator, isoform B OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
9	AFDB:Q9NCL8	0.909	0.933	6.432E-33	264	0.439	0.451	Q9NCL8.pdb.gz	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1
10	AFDB:A0A024R5I7	0.892	0.199	1.368E-31	1244	0.421	0.092	A0A024R5I7.pdb.gz
11	AFDB:F1LXD6	0.903	0.196	3.646E-31	1281	0.435	0.092	F1LXD6.pdb.gz	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3
12	AFDB:Q9NCL7	0.888	0.929	5.154E-31	259	0.450	0.471	Q9NCL7.pdb.gz	PITP2_DICDI Phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum OX=44689 GN=pitB PE=2 SV=1
13	PDB:2qimA	0.351	0.533	9.499E-4	157	0.100	0.172	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
14	PDB:5jqmC	0.374	0.417	2.130E-3	236	0.103	0.119	5jqmC.pdb.gz
15	PDB:4ryvA	0.335	0.517	1.011E-2	155	0.085	0.148	4ryvA.pdb.gz	Crystallographic and CD probing of ligand-induced conformational changes in a plant PR-10 protein.
16	PDB:3kdhA	0.334	0.441	1.134E-2	189	0.044	0.063	3kdhA.pdb.gz
17	PDB:1ifvA	0.329	0.508	1.604E-2	155	0.074	0.129	1ifvA.pdb.gz
18	PDB:4oicA	0.367	0.504	1.800E-2	182	0.063	0.093	4oicA.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
19	PDB:4qdcA	0.369	0.291	2.695E-2	369	0.100	0.073	4qdcA.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
20	PDB:4c9iF	0.301	0.431	2.855E-2	162	0.074	0.123	4c9iF.pdb.gz	The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48739	0.0	568	271	1.000	1.000	PIPNB_HUMAN Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2
2	P53811	0.0	557	271	0.974	0.974	PIPNB_MOUSE Phosphatidylinositol transfer protein beta isoform OS=Mus musculus OX=10090 GN=Pitpnb PE=1 SV=2
3	P53812	0.0	560	271	0.978	0.978	PIPNB_RAT Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=2
4	Q9TR36	0.0	565	271	0.993	0.993	PIPNB_BOVIN Phosphatidylinositol transfer protein beta isoform OS=Bos taurus OX=9913 GN=PITPNB PE=1 SV=3
5	F1QRW4	9.10e-172	476	272	0.845	0.842	F1QRW4_DANRE Phosphatidylinositol transfer protein beta isoform isoform 1 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=1
6	E7EZR3	1.12e-171	476	271	0.838	0.838	E7EZR3_DANRE Phosphatidylinositol transfer protein beta isoform isoform 2 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=3
7	Q2HJ54	2.48e-168	468	270	0.775	0.778	PIPNA_BOVIN Phosphatidylinositol transfer protein alpha isoform OS=Bos taurus OX=9913 GN=PITPNA PE=1 SV=3
8	Q00169	2.01e-166	463	270	0.775	0.778	PIPNA_HUMAN Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2
9	P53810	5.46e-165	459	271	0.779	0.779	PIPNA_MOUSE Phosphatidylinositol transfer protein alpha isoform OS=Mus musculus OX=10090 GN=Pitpna PE=1 SV=2
10	P16446	9.25e-165	459	271	0.775	0.775	PIPNA_RAT Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2
11	Q802Z3	1.72e-163	456	270	0.768	0.770	Q802Z3_DANRE Phosphatidylinositol transfer protein, beta,-like OS=Danio rerio OX=7955 GN=zgc:55645 PE=1 SV=1
12	Q803U3	6.08e-160	447	271	0.756	0.756	Q803U3_DANRE Phosphatidylinositol transfer protein alpha isoform OS=Danio rerio OX=7955 GN=pitpna PE=1 SV=1
13	Q9VDY8	2.68e-115	333	272	0.627	0.625	Q9VDY8_DROME MIP08680p OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
14	A0A0B4KGG5	1.66e-113	329	273	0.624	0.619	A0A0B4KGG5_DROME Vibrator, isoform B OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
15	Q8T3L2	4.01e-113	328	272	0.620	0.618	Q8T3L2_DROME SD01527p OS=Drosophila melanogaster OX=7227 GN=vib PE=2 SV=1
16	Q9NCL8	1.69e-80	245	264	0.439	0.451	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1
17	Q9NCL7	6.57e-79	241	259	0.446	0.467	PITP2_DICDI Phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum OX=44689 GN=pitB PE=2 SV=1
18	Q5U2N3	1.71e-69	234	1242	0.424	0.093	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
19	O00562	1.48e-68	231	1244	0.421	0.092	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
20	F1LXD6	3.38e-67	228	1331	0.443	0.090	F1LXD6_RAT Phosphatidylinositol transfer protein, membrane-associated 2 OS=Rattus norvegicus OX=10116 GN=Pitpnm2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02121 IP_trans	4.4e-114	391.8	Phosphatidylinositol transfer protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010373875.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010369571.1	0.599	May play a role as a nucleotide-sugar transporter.
2	61622.XP_010373110.1	0.595	SAC1 suppressor of actin mutations 1-like (yeast)
3	61622.XP_010358923.1	0.582	Pecanex homolog 1 (Drosophila)
4	61622.XP_010371139.1	0.571	Netrin G2
5	61622.XP_010356558.1	0.569	Netrin 1
6	61622.XP_010359475.1	0.558	OTU domain-containing protein 4 isoform X1
7	61622.XP_010374254.1	0.545	Phospholipase C gamma 1
8	61622.XP_010368301.1	0.540	Aldehyde dehydrogenase 1 family member B1
9	61622.XP_010351578.1	0.529	Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first commited step in the biosynthesis of AMP from IMP
10	61622.XP_010356402.1	0.525	Serine hydrolase involved in the detoxification of formaldehyde
11	61622.XP_010357881.1	0.522	SEC14-like protein 2 isoform X1
12	61622.XP_010357885.1	0.522	SEC14-like protein 3 isoform X1
13	61622.XP_010374182.1	0.515	Mannose phosphate isomerase
14	61622.XP_010385620.1	0.515	Saccharopine dehydrogenase (putative)
15	61622.XP_010354238.1	0.514	Netrin receptor DCC-like
16	61622.XP_010359758.1	0.514	Netrin receptor DCC
17	61622.XP_010356516.1	0.510	Component of oligomeric golgi complex 7
18	61622.XP_010378064.1	0.503	Signal transducer and activator of transcription 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008525	0.999	phosphatidylcholine transporter activity
GO:0008526	0.999	phosphatidylinositol transfer activity
GO:0043167	0.997	ion binding
GO:0005543	0.995	phospholipid binding
GO:0035091	0.991	phosphatidylinositol binding
GO:0043169	0.974	cation binding
GO:0050997	0.928	quaternary ammonium group binding
GO:0031210	0.853	phosphatidylcholine binding
GO:0005515	0.837	protein binding
GO:0120019	0.465	phosphatidylcholine transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.971	cellular process
GO:0015748	0.943	organophosphate ester transport
GO:0010876	0.941	lipid localization
GO:0032501	0.940	multicellular organismal process
GO:0006869	0.915	lipid transport
GO:0007275	0.910	multicellular organism development
GO:0015914	0.879	phospholipid transport
GO:0071840	0.875	cellular component organization or biogenesis
GO:0016043	0.871	cellular component organization
GO:0001701	0.470	in utero embryonic development
GO:0065007	0.402	biological regulation
GO:0050789	0.393	regulation of biological process
GO:0050794	0.382	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005794	0.986	Golgi apparatus
GO:0016020	0.975	membrane
GO:0031984	0.467	organelle subcompartment
GO:0031090	0.410	organelle membrane
GO:0005576	0.399	extracellular region
GO:0005829	0.302	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]