StarFunc result for job id P48740

User Input

>input (699 residues)
MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW
MNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLL
GSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTL
HPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPET
LMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQW
YLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48740	1.000	1.000	0.000	699	1.000	1.000	P48740.pdb.gz	MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo sapiens OX=9606 GN=MASP1 PE=1 SV=3
2	AFDB:P98064	0.624	0.620	0.000	704	0.863	0.857	P98064.pdb.gz	MASP1_MOUSE Mannan-binding lectin serine protease 1 OS=Mus musculus OX=10090 GN=Masp1 PE=1 SV=2
3	AFDB:Q6Q1Q8	0.760	0.732	1.065E-90	730	0.584	0.559	Q6Q1Q8.pdb.gz	Q6Q1Q8_CHICK Mannan-binding lectin associated serine protease 3 OS=Gallus gallus OX=9031 PE=2 SV=1
4	AFDB:E7FDS3	0.386	0.356	5.668E-78	766	0.465	0.424	E7FDS3.pdb.gz
5	AFDB:A0A0K2SV02	0.416	0.394	5.947E-78	740	0.465	0.439	A0A0K2SV02.pdb.gz
6	AFDB:Q6Q1Q9	0.618	0.628	1.283E-77	686	0.409	0.417	Q6Q1Q9.pdb.gz	Q6Q1Q9_CHICK Mannan-binding lectin associated serine protease 2 OS=Gallus gallus OX=9031 PE=2 SV=1
7	AFDB:Q9JJS8	0.573	0.583	1.118E-75	685	0.406	0.415	Q9JJS8.pdb.gz	MASP2_RAT Mannan-binding lectin serine protease 2 OS=Rattus norvegicus OX=10116 GN=Masp2 PE=1 SV=2
8	AFDB:O00187	0.585	0.595	1.996E-74	686	0.422	0.430	O00187.pdb.gz	MASP2_HUMAN Mannan-binding lectin serine protease 2 OS=Homo sapiens OX=9606 GN=MASP2 PE=1 SV=4
9	AFDB:F1NAB7	0.574	0.567	1.768E-67	712	0.379	0.372	F1NAB7.pdb.gz	F1NAB7_CHICK Complement C1r OS=Gallus gallus OX=9031 GN=C1R PE=1 SV=2
10	AFDB:P00736	0.646	0.642	3.146E-67	705	0.375	0.372	P00736.pdb.gz	C1R_HUMAN Complement C1r subcomponent OS=Homo sapiens OX=9606 GN=C1R PE=1 SV=2
11	PDB:4bnrA	0.309	0.873	5.653E-19	237	0.119	0.350	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
12	PDB:6i44A	0.321	0.374	5.931E-19	594	0.186	0.219	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
13	PDB:2a31A	0.299	0.905	1.342E-18	223	0.117	0.368	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
14	PDB:2ra3A	0.299	0.907	2.389E-18	224	0.119	0.371	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
15	PDB:1tgsZ	0.299	0.894	2.506E-18	225	0.122	0.378	1tgsZ.pdb.gz	Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
16	PDB:5ms3A	0.298	0.883	3.187E-18	228	0.123	0.377	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
17	PDB:4q7xA	0.306	0.876	5.152E-18	235	0.106	0.315	4q7xA.pdb.gz
18	PDB:1fiwA	0.309	0.799	5.951E-18	260	0.107	0.288	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
19	PDB:4a5tS	0.317	0.290	8.329E-18	767	0.122	0.111	4a5tS.pdb.gz
20	PDB:1cgiE	0.327	0.901	1.347E-17	245	0.116	0.331	1cgiE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W876	0.0	710	354	0.486	0.960	F8W876_HUMAN MBL associated serine protease 1 OS=Homo sapiens OX=9606 GN=MASP1 PE=1 SV=1
2	O00187	0.0	575	686	0.415	0.423	MASP2_HUMAN Mannan-binding lectin serine protease 2 OS=Homo sapiens OX=9606 GN=MASP2 PE=1 SV=4
3	P48740	0.0	1467	699	1.000	1.000	MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo sapiens OX=9606 GN=MASP1 PE=1 SV=3
4	P98064	0.0	1284	704	0.866	0.859	MASP1_MOUSE Mannan-binding lectin serine protease 1 OS=Mus musculus OX=10090 GN=Masp1 PE=1 SV=2
5	Q6Q1Q8	0.0	836	730	0.594	0.568	Q6Q1Q8_CHICK Mannan-binding lectin associated serine protease 3 OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q6Q1Q9	0.0	573	686	0.408	0.415	Q6Q1Q9_CHICK Mannan-binding lectin associated serine protease 2 OS=Gallus gallus OX=9031 PE=2 SV=1
7	Q8CHN8	0.0	1271	704	0.856	0.849	MASP1_RAT Mannan-binding lectin serine protease 1 OS=Rattus norvegicus OX=10116 GN=Masp1 PE=1 SV=2
8	Q9JJS8	0.0	572	685	0.422	0.431	MASP2_RAT Mannan-binding lectin serine protease 2 OS=Rattus norvegicus OX=10116 GN=Masp2 PE=1 SV=2
9	X1WH68	0.0	636	740	0.469	0.443	X1WH68_DANRE MBL-associated serine protease 1 OS=Danio rerio OX=7955 GN=masp1 PE=1 SV=1
10	F1NAB7	3.73e-164	491	712	0.382	0.375	F1NAB7_CHICK Complement C1r OS=Gallus gallus OX=9031 GN=C1R PE=1 SV=2
11	A0A2R8QH04	1.88e-161	472	384	0.293	0.534	A0A2R8QH04_DANRE MBL-associated serine protease 1 OS=Danio rerio OX=7955 GN=masp1 PE=1 SV=1
12	P00736	1.22e-159	479	705	0.375	0.372	C1R_HUMAN Complement C1r subcomponent OS=Homo sapiens OX=9606 GN=C1R PE=1 SV=2
13	Q6P6T1	2.93e-150	454	688	0.386	0.392	C1S_RAT Complement C1s subcomponent OS=Rattus norvegicus OX=10116 GN=C1s PE=2 SV=2
14	Q5F3N3	5.20e-144	438	690	0.361	0.365	Q5F3N3_CHICK Complement C1s subcomponent OS=Gallus gallus OX=9031 GN=RCJMB04_11h6 PE=2 SV=1
15	P09871	2.09e-143	436	688	0.359	0.365	C1S_HUMAN Complement C1s subcomponent OS=Homo sapiens OX=9606 GN=C1S PE=1 SV=1
16	Q6Q1Q7	5.58e-62	206	179	0.126	0.492	Q6Q1Q7_CHICK MAp19 OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q9Y5Y6	7.34e-48	183	855	0.265	0.216	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
18	Q9WVM6	1.04e-42	168	1012	0.147	0.102	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
19	P28175	1.20e-42	168	1019	0.163	0.112	CFC_TACTR Clotting factor C OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
20	P13497	3.89e-42	167	986	0.137	0.097	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.5	20.1	Complement Clr-like EGF-like
2	PF00431 CUB	2.3e-49	177.7	CUB domain
3	PF02408 CUB_2	4.1	18.6	CUB-like domain
4	PF09342 DUF1986	3.3e+02	13.1	Domain of unknown function (DUF1986)
5	PF07645 EGF_CA	0.086	24.4	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	1.9e-05	36.2	Coagulation Factor Xa inhibitory site
7	PF02395 Peptidase_S6	2.3e+02	11.2	Immunoglobulin A1 protease
8	PF00084 Sushi	1e-12	59.6	Sushi repeat (SCR repeat)
9	PF00089 Trypsin	1.4e-70	249.1	Trypsin
10	PF13365 Trypsin_2	1.6	21.1	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010350848.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010379900.1	0.996	Mannose-binding protein C
2	61622.XP_010361564.1	0.968	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
3	61622.XP_010361582.1	0.968	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
4	61622.XP_010381113.1	0.958	Belongs to the serpin family.
5	61622.XP_010381629.1	0.945	Belongs to the peptidase S1 family.
6	61622.XP_010381665.1	0.941	Complement C4A (Rodgers blood group)
7	61622.XP_010351827.1	0.932	Belongs to the peptidase S1 family.
8	61622.XP_010356214.1	0.857	Collectin subfamily member 11
9	61622.XP_010356093.1	0.814	Collectin-10
10	61622.XP_010378683.1	0.776	Ficolin-3
11	61622.XP_010371063.1	0.763	Ficolin-1
12	61622.XP_010371064.1	0.763	Ficolin-2 isoform X1
13	61622.XP_010371067.1	0.763	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
14	61622.XP_010358450.1	0.756	Thrombospondin type laminin G domain and EAR repeats
15	61622.XP_010357722.1	0.749	Complement C3-like
16	61622.XP_010365463.1	0.749	Complement C3
17	61622.XP_010357592.1	0.721	Complement C4-B-like
18	61622.XP_010357780.1	0.721	Complement C4-B-like
19	61622.XP_010352093.1	0.715	Hydroxysteroid 17-beta dehydrogenase 4
20	61622.XP_010368433.1	0.715	Small muscle protein, X-linked

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	1.000	serine-type endopeptidase activity
GO:0043167	0.999	ion binding
GO:0048306	0.999	calcium-dependent protein binding
GO:0046983	0.998	protein dimerization activity
GO:0042802	0.996	identical protein binding
GO:0005509	0.945	calcium ion binding
GO:0042803	0.883	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.982	regulation of biological process
GO:0050896	0.976	response to stimulus
GO:0048518	0.964	positive regulation of biological process
GO:0048583	0.958	regulation of response to stimulus
GO:0006956	0.953	complement activation
GO:0009987	0.941	cellular process
GO:0045087	0.936	innate immune response
GO:0050794	0.803	regulation of cellular process
GO:0048519	0.714	negative regulation of biological process
GO:0051716	0.559	cellular response to stimulus
GO:0007154	0.546	cell communication
GO:0023052	0.540	signaling
GO:0007165	0.510	signal transduction
GO:0031349	0.504	positive regulation of defense response
GO:0032101	0.479	regulation of response to external stimulus
GO:0002757	0.422	immune response-activating signaling pathway
GO:0002833	0.403	positive regulation of response to biotic stimulus
GO:0002768	0.400	immune response-regulating cell surface receptor signaling pathway
GO:0032103	0.394	positive regulation of response to external stimulus
GO:0071704	0.354	organic substance metabolic process
GO:0002697	0.348	regulation of immune effector process
GO:0002218	0.338	activation of innate immune response
GO:0006807	0.325	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0043226	0.701	organelle
GO:0043227	0.665	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]