StarFunc result for job id P48742

User Input

>input (406 residues)
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPS
LPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48742	0.999	0.999	2.139E-67	406	1.000	1.000	P48742.pdb.gz	LHX1_HUMAN LIM/homeobox protein Lhx1 OS=Homo sapiens OX=9606 GN=LHX1 PE=1 SV=2
2	AFDB:P61375	0.514	0.518	2.298E-53	402	0.759	0.766	P61375.pdb.gz	LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1
3	AFDB:P37137	0.603	0.609	3.393E-52	402	0.727	0.734	P37137.pdb.gz	LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis OX=8355 GN=lhx5 PE=1 SV=2
4	AFDB:P52889	0.683	0.694	8.366E-51	399	0.714	0.727	P52889.pdb.gz	LHX5_DANRE LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 GN=lhx5 PE=2 SV=1
5	AFDB:Q9V472	0.317	0.263	3.323E-31	505	0.470	0.378	Q9V472.pdb.gz	Q9V472_DROME DLim1 OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=1 SV=1
6	AFDB:P20154	0.314	0.315	5.947E-30	405	0.367	0.368	P20154.pdb.gz	LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans OX=6239 GN=lin-11 PE=1 SV=2
7	AFDB:P53776	0.305	0.318	5.285E-28	390	0.330	0.344	P53776.pdb.gz	LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus OX=10090 GN=Lhx4 PE=1 SV=4
8	AFDB:Q90421	0.304	0.309	8.826E-28	398	0.323	0.329	Q90421.pdb.gz	LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1
9	AFDB:P36200	0.302	0.310	9.410E-28	395	0.345	0.354	P36200.pdb.gz	LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1
10	AFDB:B0S5S7	0.299	0.310	1.141E-27	391	0.347	0.361	B0S5S7.pdb.gz	B0S5S7_DANRE LIM homeobox 4 OS=Danio rerio OX=7955 GN=si:dkeyp-35f11.3 PE=4 SV=1
11	PDB:4kfzB	0.166	0.421	1.667E-12	148	0.101	0.277	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.137	0.282	1.254E-5	192	0.079	0.167	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.150	0.661	2.405E-3	76	0.044	0.237	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4egcA	0.123	0.092	8.667E-3	539	0.039	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
15	PDB:5dkaA	0.068	0.230	5.243E-1	96	0.037	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:7uhyD	0.102	0.136	5.961E-1	288	0.020	0.028	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:4wa6D	0.081	0.079	1.286	415	0.022	0.022	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
18	PDB:8a3tU	0.081	0.210	1.559	114	0.049	0.175	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
19	PDB:4r8pL	0.083	0.121	1.662	254	0.032	0.051	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:2vbwA	0.084	0.209	1.772	147	0.037	0.102	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29674	0.0	782	403	0.924	0.931	LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis OX=8355 GN=lhx1 PE=1 SV=1
2	P37137	0.0	588	402	0.746	0.754	LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis OX=8355 GN=lhx5 PE=1 SV=2
3	P48742	0.0	843	406	1.000	1.000	LHX1_HUMAN LIM/homeobox protein Lhx1 OS=Homo sapiens OX=9606 GN=LHX1 PE=1 SV=2
4	P52889	0.0	553	399	0.709	0.722	LHX5_DANRE LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 GN=lhx5 PE=2 SV=1
5	P53411	0.0	803	406	0.943	0.943	LHX1_CHICK LIM/homeobox protein Lhx1 OS=Gallus gallus OX=9031 GN=LHX1 PE=2 SV=1
6	P61375	0.0	624	402	0.759	0.766	LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1
7	P63006	0.0	840	406	0.995	0.995	LHX1_MOUSE LIM/homeobox protein Lhx1 OS=Mus musculus OX=10090 GN=Lhx1 PE=1 SV=1
8	P63007	0.0	840	406	0.995	0.995	LHX1_RAT LIM/homeobox protein Lhx1 OS=Rattus norvegicus OX=10116 GN=Lhx1 PE=1 SV=1
9	Q9H2C1	0.0	595	402	0.751	0.759	LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens OX=9606 GN=LHX5 PE=1 SV=1
10	Q9V472	2.01e-107	327	505	0.446	0.358	Q9V472_DROME DLim1 OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=1 SV=1
11	P20154	7.02e-88	274	405	0.333	0.333	LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans OX=6239 GN=lin-11 PE=1 SV=2
12	B0S5S7	1.15e-79	252	391	0.303	0.315	B0S5S7_DANRE LIM homeobox 4 OS=Danio rerio OX=7955 GN=si:dkeyp-35f11.3 PE=4 SV=1
13	Q969G2	4.00e-78	248	390	0.291	0.303	LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens OX=9606 GN=LHX4 PE=1 SV=2
14	P53776	4.85e-78	248	390	0.291	0.303	LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus OX=10090 GN=Lhx4 PE=1 SV=4
15	Q90421	1.51e-74	239	398	0.296	0.302	LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio OX=7955 GN=lhx3 PE=2 SV=1
16	P36200	1.60e-74	239	395	0.293	0.301	LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis OX=8355 GN=lhx3 PE=1 SV=1
17	O97581	1.63e-73	236	383	0.377	0.399	LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa OX=9823 GN=LHX3 PE=2 SV=1
18	M9NCY1	3.69e-73	236	405	0.281	0.281	M9NCY1_DROME Lim3, isoform E OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=4 SV=1
19	A2ALD8	5.56e-73	235	402	0.355	0.358	A2ALD8_MOUSE LIM homeobox protein 3 OS=Mus musculus OX=10090 GN=Lhx3 PE=2 SV=1
20	O96686	9.22e-73	236	440	0.281	0.259	O96686_DROME LIM homeodomain transcription factor OS=Drosophila melanogaster OX=7227 GN=Lim3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	0.02	26.1	Homeobox KN domain
2	PF00046 Homeodomain	1.9e-16	70.9	Homeodomain
3	PF00412 LIM	7.5e-29	111.1	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392466	0.922	LIM domain-binding protein 1
2	9606.ENSP00000270061	0.888	Single stranded DNA binding protein 4
3	9606.ENSP00000360371	0.886	Single-stranded DNA-binding protein 3
4	9606.ENSP00000306772	0.839	LIM domain-binding protein 2
5	9606.ENSP00000359319	0.806	Paired box protein Pax-2
6	9606.ENSP00000400341	0.745	Hepatocyte nuclear factor 3-beta
7	9606.ENSP00000328596	0.738	Homeobox protein SIX6
8	9606.ENSP00000328059	0.701	E3 ubiquitin-protein ligase RLIM
9	9606.ENSP00000304502	0.683	Homeobox protein SIX2
10	9606.ENSP00000317333	0.659	Neurogenin-2
11	9606.ENSP00000296921	0.644	T-cell leukemia homeobox protein 3
12	9606.ENSP00000295886	0.643	Homeobox protein Nkx-6.1
13	9606.ENSP00000263334	0.638	Paired box protein Pax-8
14	9606.ENSP00000343819	0.633	Homeobox protein OTX2
15	9606.ENSP00000293805	0.629	B-cell CLL/lymphoma 6 member B protein
16	9606.ENSP00000359212	0.624	Transcription factor LBX1
17	9606.ENSP00000354607	0.612	Frizzled-5
18	9606.ENSP00000450962	0.608	Homeobox protein EMX2
19	9606.ENSP00000290167	0.607	Protein Wnt-4
20	9606.ENSP00000251020	0.606	Sal-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.869	transcription regulator activity
GO:0000976	0.775	transcription cis-regulatory region binding
GO:0003700	0.716	DNA-binding transcription factor activity
GO:0000977	0.679	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.499	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.380	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.997	multicellular organismal process
GO:0048856	0.997	anatomical structure development
GO:0048731	0.990	system development
GO:0050789	0.981	regulation of biological process
GO:0048513	0.980	animal organ development
GO:0050794	0.972	regulation of cellular process
GO:0019222	0.925	regulation of metabolic process
GO:0009987	0.919	cellular process
GO:0010468	0.910	regulation of gene expression
GO:0007399	0.904	nervous system development
GO:0031323	0.902	regulation of cellular metabolic process
GO:0009653	0.896	anatomical structure morphogenesis
GO:0080090	0.877	regulation of primary metabolic process
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0019219	0.863	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.831	response to stimulus
GO:0072006	0.821	nephron development
GO:0010556	0.819	regulation of macromolecule biosynthetic process
GO:0031326	0.819	regulation of cellular biosynthetic process
GO:0051252	0.819	regulation of RNA metabolic process
GO:0072073	0.811	kidney epithelium development
GO:2001141	0.802	regulation of RNA biosynthetic process
GO:0006355	0.765	regulation of DNA-templated transcription
GO:0048518	0.661	positive regulation of biological process
GO:0048522	0.636	positive regulation of cellular process
GO:0009887	0.622	animal organ morphogenesis
GO:0048869	0.600	cellular developmental process
GO:0030154	0.574	cell differentiation
GO:0010604	0.497	positive regulation of macromolecule metabolic process
GO:0051173	0.492	positive regulation of nitrogen compound metabolic process
GO:0031325	0.466	positive regulation of cellular metabolic process
GO:0045935	0.453	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.451	regulation of transcription by RNA polymerase II
GO:0022008	0.422	neurogenesis
GO:0048523	0.416	negative regulation of cellular process
GO:0010557	0.390	positive regulation of macromolecule biosynthetic process
GO:0051254	0.384	positive regulation of RNA metabolic process
GO:0031328	0.365	positive regulation of cellular biosynthetic process
GO:0045893	0.360	positive regulation of DNA-templated transcription
GO:0045944	0.328	positive regulation of transcription by RNA polymerase II
GO:0009892	0.307	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.960	protein-containing complex
GO:0031981	0.660	nuclear lumen
GO:0005667	0.422	transcription regulator complex
GO:0005654	0.358	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]