StarFunc result for job id P48745

User Input

>input (357 residues)
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDG
CSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9J4	0.566	0.566	1.168E-63	357	1.000	1.000	A0A024R9J4.pdb.gz
2	AFDB:Q64299	0.511	0.514	1.828E-57	354	0.801	0.808	Q64299.pdb.gz	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
3	AFDB:Q5RI33	0.411	0.424	1.621E-40	345	0.501	0.519	Q5RI33.pdb.gz	Q5RI33_DANRE Cellular communication network factor 2a (Fragment) OS=Danio rerio OX=7955 GN=ctgf PE=2 SV=1
4	AFDB:P29279	0.435	0.442	4.049E-40	349	0.473	0.484	P29279.pdb.gz	CCN2_HUMAN CCN family member 2 OS=Homo sapiens OX=9606 GN=CCN2 PE=1 SV=2
5	AFDB:Q98TQ8	0.430	0.444	9.077E-40	344	0.487	0.506	Q98TQ8.pdb.gz	Q98TQ8_CHICK Cellular communication network factor 2 OS=Gallus gallus OX=9031 GN=CCN2 PE=2 SV=1
6	AFDB:O00622	0.365	0.343	4.932E-37	381	0.434	0.407	O00622.pdb.gz	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
7	AFDB:Q6PFL2	0.378	0.340	4.991E-36	400	0.409	0.365	Q6PFL2.pdb.gz
8	AFDB:O54775	0.381	0.372	2.253E-35	367	0.378	0.368	O54775.pdb.gz	CCN4_MOUSE CCN family member 4 OS=Mus musculus OX=10090 GN=Ccn4 PE=2 SV=1
9	AFDB:O95388	0.408	0.398	1.940E-34	367	0.367	0.357	O95388.pdb.gz	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
10	AFDB:D0E2W2	0.404	0.422	3.635E-31	338	0.331	0.349	D0E2W2.pdb.gz	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1
11	PDB:2k8pA	0.163	0.268	2.122E-2	189	0.048	0.090	2k8pA.pdb.gz
12	PDB:4a5wB	0.101	0.045	1.011E-1	871	0.050	0.021	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
13	PDB:5ntuA	0.107	0.121	1.188E-1	308	0.048	0.055	5ntuA.pdb.gz
14	PDB:2dsbA	0.116	0.170	1.641E-1	206	0.034	0.058	2dsbA.pdb.gz
15	PDB:4my2A	0.105	0.080	2.035E-1	474	0.056	0.042	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
16	PDB:5nxsA	0.147	0.176	2.035E-1	290	0.056	0.069	5nxsA.pdb.gz
17	PDB:1wq8A	0.124	0.356	2.266E-1	100	0.034	0.120	1wq8A.pdb.gz
18	PDB:3t5oA	0.094	0.041	2.391E-1	871	0.076	0.031	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:7t9iB	0.144	0.389	2.966E-1	109	0.045	0.147	7t9iB.pdb.gz
20	PDB:6umxA	0.137	0.170	3.303E-1	279	0.050	0.065	6umxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48745	0.0	723	357	1.000	1.000	CCN3_HUMAN CCN family member 3 OS=Homo sapiens OX=9606 GN=CCN3 PE=1 SV=1
2	Q64299	0.0	594	354	0.801	0.808	CCN3_MOUSE CCN family member 3 OS=Mus musculus OX=10090 GN=Ccn3 PE=1 SV=1
3	Q9QZQ5	0.0	575	351	0.801	0.815	CCN3_RAT CCN family member 3 OS=Rattus norvegicus OX=10116 GN=Ccn3 PE=1 SV=1
4	Q5RI33	2.36e-124	363	345	0.493	0.510	Q5RI33_DANRE Cellular communication network factor 2a (Fragment) OS=Danio rerio OX=7955 GN=ctgf PE=2 SV=1
5	P29279	2.76e-120	353	349	0.490	0.501	CCN2_HUMAN CCN family member 2 OS=Homo sapiens OX=9606 GN=CCN2 PE=1 SV=2
6	Q98TQ8	1.98e-119	350	344	0.487	0.506	Q98TQ8_CHICK Cellular communication network factor 2 OS=Gallus gallus OX=9031 GN=CCN2 PE=2 SV=1
7	Q9R1E9	2.74e-118	347	347	0.468	0.481	CCN2_RAT CCN family member 2 OS=Rattus norvegicus OX=10116 GN=Ccn2 PE=2 SV=1
8	P29268	5.11e-118	347	348	0.493	0.506	CCN2_MOUSE CCN family member 2 OS=Mus musculus OX=10090 GN=Ccn2 PE=1 SV=3
9	F1QL10	6.44e-90	276	369	0.437	0.423	F1QL10_DANRE Cellular communication network factor 1 OS=Danio rerio OX=7955 GN=cyr61 PE=3 SV=1
10	Q9ES72	2.18e-82	257	379	0.437	0.412	CCN1_RAT CCN family member 1 OS=Rattus norvegicus OX=10116 GN=Ccn1 PE=2 SV=1
11	O00622	2.26e-82	257	381	0.445	0.417	CCN1_HUMAN CCN family member 1 OS=Homo sapiens OX=9606 GN=CCN1 PE=1 SV=1
12	P18406	5.06e-82	256	379	0.434	0.409	CCN1_MOUSE CCN family member 1 OS=Mus musculus OX=10090 GN=Ccn1 PE=1 SV=1
13	Q99PP0	1.47e-79	249	367	0.364	0.354	CCN4_RAT CCN family member 4 OS=Rattus norvegicus OX=10116 GN=Ccn4 PE=2 SV=1
14	O95388	1.62e-79	249	367	0.370	0.360	CCN4_HUMAN CCN family member 4 OS=Homo sapiens OX=9606 GN=CCN4 PE=1 SV=1
15	O54775	7.03e-79	248	367	0.364	0.354	CCN4_MOUSE CCN family member 4 OS=Mus musculus OX=10090 GN=Ccn4 PE=2 SV=1
16	D0E2W2	1.32e-62	205	338	0.328	0.346	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1
17	A0A384NYW3	5.05e-59	196	354	0.333	0.336	A0A384NYW3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
18	O95389	5.05e-59	196	354	0.333	0.336	CCN6_HUMAN Cellular communication network factor 6 OS=Homo sapiens OX=9606 GN=CCN6 PE=1 SV=1
19	Q9Z0G4	6.53e-53	177	251	0.286	0.406	CCN5_MOUSE CCN family member 5 OS=Mus musculus OX=10090 GN=Ccn5 PE=2 SV=1
20	O76076	2.51e-49	167	250	0.261	0.372	CCN5_HUMAN CCN family member 5 OS=Homo sapiens OX=9606 GN=CCN5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	9.3e-08	43.7	Cystine-knot domain
2	PF00219 IGFBP	5.5e-08	44.6	Insulin-like growth factor binding protein
3	PF19035 TSP1_CCN	5.4e-15	66.8	CCN3 Nov like TSP1 domain
4	PF00093 VWC	1.4e-06	39.8	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.989	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000282561	0.980	Gap junction alpha-1 protein
3	9606.ENSP00000301788	0.915	DNA-directed RNA polymerase II subunit RPB7
4	9606.ENSP00000368104	0.846	Bone morphogenetic protein 2
5	9606.ENSP00000353094	0.726	45 kDa calcium-binding protein
6	9606.ENSP00000369071	0.718	Periostin
7	9606.ENSP00000357705	0.716	S100 calcium binding protein A4
8	9606.ENSP00000370842	0.710	Interleukin-33
9	9606.ENSP00000295666	0.659	Insulin-like growth factor-binding protein 7
10	9606.ENSP00000241125	0.646	Gap junction alpha-3 protein
11	9606.ENSP00000331544	0.618	Fibulin-1
12	9606.ENSP00000261023	0.592	Integrin alpha-V
13	9606.ENSP00000380432	0.587	Insulin
14	9606.ENSP00000346839	0.586	Fibronectin type III domain containing
15	9606.ENSP00000231061	0.577	SPARC
16	9606.ENSP00000261405	0.571	Von Willebrand factor
17	9606.ENSP00000280527	0.559	Cysteine-rich motor neuron 1 protein
18	9606.ENSP00000278243	0.544	Post-GPI attachment to proteins factor 2
19	9606.ENSP00000377061	0.538	Plexin-A1
20	9606.ENSP00000370473	0.528	Insulin-like growth factor-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0050839	0.762	cell adhesion molecule binding
GO:0005178	0.732	integrin binding
GO:0140677	0.663	molecular function activator activity
GO:0030545	0.438	signaling receptor regulator activity
GO:0048018	0.434	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048519	0.998	negative regulation of biological process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0032501	0.993	multicellular organismal process
GO:0048583	0.982	regulation of response to stimulus
GO:0007275	0.966	multicellular organism development
GO:0051239	0.960	regulation of multicellular organismal process
GO:0048523	0.954	negative regulation of cellular process
GO:0048731	0.940	system development
GO:0048513	0.936	animal organ development
GO:0023051	0.934	regulation of signaling
GO:0010646	0.934	regulation of cell communication
GO:0009888	0.926	tissue development
GO:0030154	0.925	cell differentiation
GO:0061448	0.898	connective tissue development
GO:0048518	0.893	positive regulation of biological process
GO:0019222	0.876	regulation of metabolic process
GO:0048522	0.875	positive regulation of cellular process
GO:0051216	0.865	cartilage development
GO:0032102	0.851	negative regulation of response to external stimulus
GO:0060255	0.845	regulation of macromolecule metabolic process
GO:0050896	0.822	response to stimulus
GO:0002062	0.802	chondrocyte differentiation
GO:0010648	0.784	negative regulation of cell communication
GO:0010468	0.777	regulation of gene expression
GO:0042127	0.768	regulation of cell population proliferation
GO:0009966	0.762	regulation of signal transduction
GO:0050793	0.747	regulation of developmental process
GO:0080134	0.731	regulation of response to stress
GO:0051241	0.693	negative regulation of multicellular organismal process
GO:0040012	0.686	regulation of locomotion
GO:0023057	0.672	negative regulation of signaling
GO:0051716	0.648	cellular response to stimulus
GO:0048584	0.614	positive regulation of response to stimulus
GO:0030334	0.567	regulation of cell migration
GO:0023056	0.554	positive regulation of signaling
GO:0050727	0.554	regulation of inflammatory response
GO:0010647	0.554	positive regulation of cell communication
GO:0007154	0.529	cell communication
GO:1902531	0.522	regulation of intracellular signal transduction
GO:0023052	0.515	signaling
GO:0007165	0.514	signal transduction
GO:0045595	0.485	regulation of cell differentiation
GO:0042221	0.453	response to chemical
GO:0031323	0.441	regulation of cellular metabolic process
GO:0009967	0.430	positive regulation of signal transduction
GO:0032879	0.423	regulation of localization
GO:0080090	0.415	regulation of primary metabolic process
GO:0008283	0.413	cell population proliferation
GO:0009893	0.401	positive regulation of metabolic process
GO:0065008	0.397	regulation of biological quality
GO:0051094	0.391	positive regulation of developmental process
GO:0010604	0.366	positive regulation of macromolecule metabolic process
GO:0051171	0.357	regulation of nitrogen compound metabolic process
GO:0009968	0.356	negative regulation of signal transduction
GO:0051093	0.355	negative regulation of developmental process
GO:2000146	0.336	negative regulation of cell motility
GO:0009889	0.334	regulation of biosynthetic process
GO:0008284	0.332	positive regulation of cell population proliferation
GO:0009653	0.311	anatomical structure morphogenesis
GO:0043408	0.307	regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0005576	0.976	extracellular region
GO:0071944	0.975	cell periphery
GO:0012505	0.882	endomembrane system
GO:0031982	0.832	vesicle
GO:0016020	0.792	membrane
GO:0005615	0.788	extracellular space
GO:0043233	0.782	organelle lumen
GO:0070013	0.762	intracellular organelle lumen
GO:0005634	0.669	nucleus
GO:0032991	0.492	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]