StarFunc result for job id P48751

User Input

>input (1232 residues)
MANGVIPPPGGASPLPQVRVPLEEPPLSPDVEEEDDDLGKTLAVSRFGDLISKPPAWDPE
KPSRSYSERDFEFHRHTSHHTHHPLSARLPPPHKLRRLPPTSARHTRRKRKKEKTSAPPS
EGTPPIQEEGGAGVDEEEEEEEEEEGESEAEPVEPPHSGTPQKAKFSIGSDEDDSPGLPG
RAAVTKPLPSVGPHTDKSPQHSSSSPSPRARASRLAGEKSRPWSPSASYDLRERLCPGSA
LGNPGGPEQQVPTDEAEAQMLGSADLDDMKSHRLEDNPGVRRHLVKKPSRTQGGRGSPSG
LAPILRRKKKKKKLDRRPHEVFVELNELMLDRSQEPHWRETARWIKFEEDVEEETERWGK
PHVASLSFRSLLELRRTIAHGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRT
LLLKHSHPNDDKDSGFFPRNPSSSSMNSVLGNHHPTPSHGPDGAVPTMADDLGEPAPLWP
HDPDAKEKPLHMPGGDGHRGKSLKLLEKIPEDAEATVVLVGCVPFLEQPAAAFVRLNEAV
LLESVLEVPVPVRFLFVMLGPSHTSTDYHELGRSIATLMSDKLFHEAAYQADDRQDLLSA
ISEFLDGSIVIPPSEVEGRDLLRSVAAFQRELLRKRREREQTKVEMTTRGGYTAPGKELS
LELGGSEATPEDDPLLRTGSVFGGLVRDVRRRYPHYPSDLRDALHSQCVAAVLFIYFAAL
SPAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGPLLVFEEAFFK
FCRAQDLEYLTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETF
YKLYKVFTEHPLLPFYPPEGALEGSLDAGLEPNGSALPPTEGPPSPRNQPNTALLSLILM
LGTFFIAFFLRKFRNSRFLGGKARRIIGDFGIPISILVMVLVDYSITDTYTQKLTVPTGL
SVTSPDKRSWFIPPLGSARPFPPWMMVAAAVPALLVLILIFMETQITALIVSQKARRLLK
GSGFHLDLLLIGSLGGLCGLFGLPWLTAATVRSVTHVNALTVMRTAIAPGDKPQIQEVRE
QRVTGVLIASLVGLSIVMGAVLRRIPLAVLFGIFLYMGVTSLSGIQLSQRLLLILMPAKH
HPEQPYVTKVKTWRMHLFTCIQLGCIALLWVVKSTAASLAFPFLLLLTVPLRHCLLPRLF
QDRELQALDSEDAEPNFDEDGQDEYNELHMPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A9NIM6	0.638	0.638	0.000	1232	0.590	0.590	A9NIM6.pdb.gz	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
2	AFDB:B0S7B8	0.693	0.695	0.000	1228	0.574	0.576	B0S7B8.pdb.gz	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
3	AFDB:P04920	0.592	0.588	0.000	1241	0.594	0.590	P04920.pdb.gz	B3A2_HUMAN Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4
4	AFDB:P48751	1.000	1.000	0.000	1232	1.000	1.000	P48751.pdb.gz	B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens OX=9606 GN=SLC4A3 PE=1 SV=2
5	PDB:8cs9g	0.423	0.621	4.112E-79	832	0.394	0.583	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
6	PDB:7tvzA	0.479	0.655	1.354E-77	850	0.396	0.574	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
7	AFDB:A0A2R8PYB9	0.420	0.462	4.452E-73	1114	0.322	0.356	A0A2R8PYB9.pdb.gz
8	AFDB:O88343	0.592	0.672	1.534E-71	1079	0.320	0.365	O88343.pdb.gz	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
9	AFDB:Q5DTL9	0.548	0.598	1.507E-70	1118	0.315	0.347	Q5DTL9.pdb.gz	S4A10_MOUSE Sodium-driven chloride bicarbonate exchanger OS=Mus musculus OX=10090 GN=Slc4a10 PE=1 SV=2
10	AFDB:G5EDF4	0.515	0.543	1.367E-67	1161	0.283	0.301	G5EDF4.pdb.gz	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
11	AFDB:Q8BTY2	0.335	0.397	4.168E-54	1034	0.274	0.326	Q8BTY2.pdb.gz	S4A7_MOUSE Sodium bicarbonate cotransporter 3 OS=Mus musculus OX=10090 GN=Slc4a7 PE=1 SV=2
12	PDB:4yzfA	0.379	0.973	2.583E-45	475	0.269	0.699	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
13	PDB:6caaA	0.357	0.895	6.712E-28	477	0.171	0.442	6caaA.pdb.gz
14	PDB:5l25A	0.268	0.746	7.373E-13	399	0.088	0.271	5l25A.pdb.gz
15	PDB:7lguA	0.254	0.425	7.255E-7	680	0.054	0.097	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
16	PDB:5i6cA	0.234	0.510	1.096E-4	480	0.055	0.142	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
17	PDB:7ch1A	0.230	0.399	1.434E-4	640	0.051	0.098	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:3qe7A	0.206	0.507	1.500E-4	407	0.068	0.206	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
19	PDB:1a6jB	0.066	0.457	9.252E-3	157	0.016	0.127	1a6jB.pdb.gz
20	AFDB:Q9VDW3	0.051	0.041	8.216E-1	1669	0.125	0.092	Q9VDW3.pdb.gz	DMDB_DROME Dystrophin, isoform B OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	1410	1170	0.619	0.652	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	653	1073	0.310	0.356	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A9NIM6	1348	1232	0.593	0.593	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
4	B0S7B8	1287	1228	0.575	0.577	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
5	D1FTM8	805	851	0.321	0.464	D1FTM8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a1b PE=2 SV=1
6	E9Q3M5	619	1116	0.305	0.337	S4A5_MOUSE Electrogenic sodium bicarbonate cotransporter 4 OS=Mus musculus OX=10090 GN=Slc4a5 PE=1 SV=1
7	G5EC65	590	1119	0.300	0.331	G5EC65_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
8	G5EDF4	589	1161	0.296	0.314	G5EDF4_CAEEL Anion exchange protein OS=Caenorhabditis elegans OX=6239 GN=abts-1 PE=1 SV=1
9	M9PB59	616	1134	0.290	0.315	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
10	M9PB60	624	1126	0.298	0.326	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
11	M9PC92	615	1086	0.290	0.329	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
12	M9PC95	615	1046	0.298	0.351	M9PC95_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
13	M9PCF0	622	1067	0.298	0.344	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
14	M9PCT2	618	1027	0.295	0.353	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
15	M9PF01	620	1053	0.295	0.345	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
16	O13134	660	1035	0.311	0.370	S4A4_AMBTI Electrogenic sodium bicarbonate cotransporter 1 OS=Ambystoma tigrinum OX=8305 GN=SLC4A4 PE=2 SV=1
17	O88343	657	1079	0.306	0.349	S4A4_MOUSE Electrogenic sodium bicarbonate cotransporter 1 OS=Mus musculus OX=10090 GN=Slc4a4 PE=1 SV=2
18	P02730	943	911	0.416	0.562	B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3
19	P04919	917	929	0.405	0.537	B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus OX=10090 GN=Slc4a1 PE=1 SV=1
20	P04920	1284	1241	0.601	0.596	B3A2_HUMAN Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	3.7e-100	346.6	Band 3 cytoplasmic domain
2	PF00955 HCO3_cotransp	2.2e-195	661.8	HCO3- transporter family
3	PF00359 PTS_EIIA_2	7.7	17.9	Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003818716.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008969954.1	0.671	Solute carrier family 26 member 6
2	9597.XP_003826956.2	0.667	Leucine rich repeat LGI family member 2
3	9597.XP_003831193.1	0.666	Solute carrier family 26 member 11
4	9597.XP_008949293.1	0.594	Motor protein that converts auditory stimuli to length changes in outer hair cells and mediates sound amplification in the mammalian hearing organ
5	9597.XP_003821185.1	0.593	Solute carrier family 26 member 7
6	9597.XP_008974785.1	0.588	DIDS- and thiosulfate- sensitive anion exchanger mediating chloride, sulfate and oxalate transport.
7	9597.XP_003826324.1	0.548	Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family
8	9597.XP_003810640.1	0.538	Otoraplin
9	9597.XP_003807303.1	0.507	Voltage-dependent L-type calcium channel subunit alpha-1F isoform X1
10	9597.XP_003811254.1	0.505	Sodium-independent transporter of chloride and iodide.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022853	1.000	active monoatomic ion transmembrane transporter activity
GO:0015106	1.000	bicarbonate transmembrane transporter activity
GO:0015108	1.000	chloride transmembrane transporter activity
GO:0005452	1.000	solute:inorganic anion antiporter activity
GO:0140900	0.954	chloride:bicarbonate antiporter activity
GO:0022890	0.848	inorganic cation transmembrane transporter activity
GO:0008324	0.847	monoatomic cation transmembrane transporter activity
GO:0046873	0.712	metal ion transmembrane transporter activity
GO:0015081	0.630	sodium ion transmembrane transporter activity
GO:0015293	0.354	symporter activity
GO:0015294	0.310	solute:monoatomic cation symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0006810	0.969	transport
GO:0009987	0.823	cellular process
GO:0006811	0.688	monoatomic ion transport
GO:0050789	0.557	regulation of biological process
GO:0071702	0.357	organic substance transport
GO:0048878	0.323	chemical homeostasis
GO:0006820	0.309	monoatomic anion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	1.000	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:29823	1.000	chloride(in) = chloride(out)
RHEA:34963	0.630	Na(+)(in) = Na(+)(out)

[back to server]