StarFunc result for job id P48775

User Input

>input (406 residues)
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48775	1.000	1.000	4.127E-52	406	1.000	1.000	P48775.pdb.gz	T23O_HUMAN Tryptophan 2,3-dioxygenase OS=Homo sapiens OX=9606 GN=TDO2 PE=1 SV=1
2	AFDB:P21643	0.958	0.958	3.730E-48	406	0.887	0.887	P21643.pdb.gz	T23O_RAT Tryptophan 2,3-dioxygenase OS=Rattus norvegicus OX=10116 GN=Tdo2 PE=1 SV=1
3	PDB:6pyzA	0.865	0.994	1.523E-42	353	0.865	0.994	6pyzA.pdb.gz	Structural Basis of Inhibitor Selectivity in Human Indoleamine 2,3-Dioxygenase 1 and Tryptophan Dioxygenase.
4	PDB:6pyzC	0.815	0.993	1.767E-39	333	0.813	0.991	6pyzC.pdb.gz	Structural Basis of Inhibitor Selectivity in Human Indoleamine 2,3-Dioxygenase 1 and Tryptophan Dioxygenase.
5	AFDB:P20351	0.857	0.917	1.500E-31	379	0.532	0.570	P20351.pdb.gz	T23O_DROME Tryptophan 2,3-dioxygenase OS=Drosophila melanogaster OX=7227 GN=v PE=1 SV=1
6	AFDB:Q17P71	0.874	0.903	3.683E-31	393	0.512	0.529	Q17P71.pdb.gz	T23O_AEDAE Tryptophan 2,3-dioxygenase OS=Aedes aegypti OX=7159 GN=AAEL000428 PE=1 SV=1
7	PDB:4pw8F	0.731	0.975	2.046E-30	303	0.746	1.000	4pw8F.pdb.gz
8	PDB:6a4iD	0.690	0.964	3.592E-29	290	0.700	0.979	6a4iD.pdb.gz	Crystal Structure of human TDO inhibitor complex
9	PDB:4hkaA	0.811	0.950	3.800E-27	345	0.502	0.591	4hkaA.pdb.gz	Crystal structure of Drosophila melanogaster tryptophan 2,3-dioxygenase reveals insights into substrate recognition and catalytic mechanism.
10	AFDB:Q1LK00	0.548	0.731	3.128E-11	299	0.222	0.301	Q1LK00.pdb.gz	T23O_CUPMC Tryptophan 2,3-dioxygenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=kynA PE=1 SV=1
11	AFDB:Q8PDA8	0.589	0.789	7.678E-11	298	0.224	0.305	Q8PDA8.pdb.gz	T23O_XANCP Tryptophan 2,3-dioxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=kynA PE=1 SV=1
12	PDB:7p46A	0.569	0.807	1.403E-10	281	0.212	0.306	7p46A.pdb.gz	Binding of l-kynurenine to X. campestris tryptophan 2,3-dioxygenase.
13	PDB:2noxB	0.536	0.803	3.778E-9	266	0.195	0.297	2noxB.pdb.gz	Crystal structure and mechanism of tryptophan 2,3-dioxygenase, a heme enzyme involved in tryptophan catabolism and in quinolinate biosynthesis.
14	AFDB:P47125	0.439	0.396	1.618E-1	453	0.099	0.088	P47125.pdb.gz	I23O_YEAST Indoleamine 2,3-dioxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA2 PE=1 SV=1
15	AFDB:P36632	0.130	0.092	2.004E-1	614	0.099	0.065	P36632.pdb.gz	RAD26_SCHPO DNA repair protein rad26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad26 PE=1 SV=2
16	AFDB:P78966	0.120	0.048	2.821E-1	1336	0.121	0.037	P78966.pdb.gz	MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mam1 PE=3 SV=1
17	PDB:7mitE	0.129	0.050	2.833E-1	1438	0.135	0.038	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
18	AFDB:Q94FB9	0.135	0.049	3.348E-1	1337	0.143	0.043	Q94FB9.pdb.gz	AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCD1 PE=1 SV=1
19	PDB:7vluA	0.120	0.052	5.616E-1	1159	0.133	0.047	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
20	PDB:5n4wA	0.099	0.069	6.955E-1	671	0.108	0.066	5n4wA.pdb.gz	Crystal Structure of the Cul2-Rbx1-EloBC-VHL Ubiquitin Ligase Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21643	0.0	734	406	0.855	0.855	T23O_RAT Tryptophan 2,3-dioxygenase OS=Rattus norvegicus OX=10116 GN=Tdo2 PE=1 SV=1
2	P48775	0.0	841	406	1.000	1.000	T23O_HUMAN Tryptophan 2,3-dioxygenase OS=Homo sapiens OX=9606 GN=TDO2 PE=1 SV=1
3	P20351	2.84e-146	422	379	0.534	0.573	T23O_DROME Tryptophan 2,3-dioxygenase OS=Drosophila melanogaster OX=7227 GN=v PE=1 SV=1
4	Q17P71	1.13e-140	408	393	0.510	0.527	T23O_AEDAE Tryptophan 2,3-dioxygenase OS=Aedes aegypti OX=7159 GN=AAEL000428 PE=1 SV=1
5	Q1LK00	8.98e-25	105	299	0.232	0.314	T23O_CUPMC Tryptophan 2,3-dioxygenase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=kynA PE=1 SV=1
6	Q8PDA8	2.12e-20	92.8	298	0.143	0.195	T23O_XANCP Tryptophan 2,3-dioxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=kynA PE=1 SV=1
7	P50295	0.47	34.7	290	0.089	0.124	ARY2_MOUSE Arylamine N-acetyltransferase 2 OS=Mus musculus OX=10090 GN=Nat2 PE=1 SV=1
8	P50298	1.0	33.9	290	0.089	0.124	ARY2_RAT Arylamine N-acetyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Nat2 PE=1 SV=1
9	Q57TX7	1.1	34.3	2197	0.079	0.015	Q57TX7_TRYB2 Kinetoplast DNA-associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.380 PE=4 SV=1
10	F4JY12	3.8	32.3	1639	0.069	0.017	GFS12_ARATH Protein GFS12 OS=Arabidopsis thaliana OX=3702 GN=GFS12 PE=1 SV=1
11	Q7TN00	5.3	32.0	3410	0.076	0.009	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
12	P18440	5.6	31.6	290	0.081	0.114	ARY1_HUMAN Arylamine N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=NAT1 PE=1 SV=2
13	A0A8I5ZUN3	7.3	31.6	35375	0.076	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
14	Q6ZPF3	7.4	31.6	1715	0.052	0.012	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
15	Q9P7T1	7.7	31.6	4924	0.034	0.003	SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sib1 PE=1 SV=1
16	Q9VGW1	8.0	31.6	1943	0.052	0.011	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
17	A0A0B4KEM1	9.4	31.2	3094	0.047	0.006	A0A0B4KEM1_DROME Toutatis, isoform G OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
18	Q67XG0	9.8	30.0	175	0.057	0.131	GLB3_ARATH Two-on-two hemoglobin-3 OS=Arabidopsis thaliana OX=3702 GN=GLB3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11305 DUF3107	9.9e+02	11.5	Protein of unknown function (DUF3107)
2	PF03301 Trp_dioxygenase	4.2e-167	567.4	Tryptophan 2,3-dioxygenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264170	0.995	Kynureninase
2	9606.ENSP00000443432	0.982	Indoleamine 2,3-dioxygenase 2
3	9606.ENSP00000328938	0.977	Kynurenine formamidase
4	9606.ENSP00000430950	0.971	Indoleamine 2,3-dioxygenase 1
5	9606.ENSP00000250018	0.970	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
6	9606.ENSP00000329093	0.945	Tryptophan hydroxylase 2
7	9606.ENSP00000355517	0.945	Kynurenine 3-monooxygenase
8	9606.ENSP00000403644	0.928	Aromatic-L-amino-acid decarboxylase
9	9606.ENSP00000472474	0.910	L-amino-acid oxidase
10	9606.ENSP00000348234	0.888	Tyrosine aminotransferase
11	9606.ENSP00000294973	0.867	3-hydroxyanthranilate 3,4-dioxygenase
12	9606.ENSP00000370718	0.831	N-acetylserotonin O-methyltransferase-like protein
13	9606.ENSP00000242057	0.802	Aryl hydrocarbon receptor
14	9606.ENSP00000399415	0.765	Kynurenine--oxoglutarate transaminase 1
15	9606.ENSP00000378782	0.752	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
16	9606.ENSP00000348459	0.736	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase
17	9606.ENSP00000264424	0.731	Guanylate cyclase soluble subunit beta-1
18	9606.ENSP00000423190	0.706	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
19	9606.ENSP00000414904	0.705	Cathepsin O
20	9606.ENSP00000260508	0.697	Kynurenine--oxoglutarate transaminase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0020037	0.999	heme binding
GO:0004833	0.999	tryptophan 2,3-dioxygenase activity
GO:0005515	0.993	protein binding
GO:0042802	0.962	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:1901360	0.929	organic cyclic compound metabolic process
GO:0044281	0.928	small molecule metabolic process
GO:0006725	0.927	cellular aromatic compound metabolic process
GO:0019752	0.922	carboxylic acid metabolic process
GO:0046483	0.918	heterocycle metabolic process
GO:0034641	0.918	cellular nitrogen compound metabolic process
GO:0044248	0.864	cellular catabolic process
GO:1901575	0.841	organic substance catabolic process
GO:1901606	0.817	alpha-amino acid catabolic process
GO:1901361	0.812	organic cyclic compound catabolic process
GO:0019439	0.808	aromatic compound catabolic process
GO:0009063	0.757	amino acid catabolic process
GO:0009072	0.752	aromatic amino acid metabolic process
GO:0044270	0.750	cellular nitrogen compound catabolic process
GO:0046700	0.749	heterocycle catabolic process
GO:0009308	0.748	amine metabolic process
GO:0009074	0.738	aromatic amino acid family catabolic process
GO:0006568	0.717	tryptophan metabolic process
GO:0050896	0.433	response to stimulus
GO:0065007	0.358	biological regulation
GO:0042537	0.345	benzene-containing compound metabolic process
GO:0070189	0.333	kynurenine metabolic process
GO:0050789	0.325	regulation of biological process
GO:0050794	0.315	regulation of cellular process
GO:0019441	0.314	tryptophan catabolic process to kynurenine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.913	organelle
GO:0043227	0.898	membrane-bounded organelle
GO:0043229	0.861	intracellular organelle
GO:0043231	0.813	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24536	0.999	L-tryptophan + O2 = N-formyl-L-kynurenine
EC:1.13.11.11	0.999	tryptophan 2,3-dioxygenase.

[back to server]