StarFunc result for job id P48788

User Input

>input (182 residues)
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES
ES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02643	0.602	0.602	1.871E-23	182	0.962	0.962	P02643.pdb.gz	TNNI2_RABIT Troponin I, fast skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI2 PE=1 SV=3
2	AFDB:P13413	0.526	0.514	5.054E-14	187	0.571	0.556	P13413.pdb.gz	TNNI1_RAT Troponin I, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni1 PE=1 SV=2
3	AFDB:F8W4T8	0.526	0.526	1.897E-13	182	0.560	0.560	F8W4T8.pdb.gz
4	AFDB:A0A2R8RX09	0.479	0.420	1.886E-12	208	0.544	0.476	A0A2R8RX09.pdb.gz
5	AFDB:A0A060W3E5	0.544	0.555	2.168E-12	178	0.582	0.596	A0A060W3E5.pdb.gz	A0A060W3E5_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065901001 PE=4 SV=1
6	AFDB:A0A060VX54	0.513	0.425	3.291E-12	221	0.555	0.457	A0A060VX54.pdb.gz	A0A060VX54_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00080162001 PE=4 SV=1
7	AFDB:A0A060Y5I6	0.442	0.540	2.298E-10	148	0.423	0.520	A0A060Y5I6.pdb.gz	A0A060Y5I6_ONCMY Troponin I type 1a (skeletal, slow) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00003364001 PE=4 SV=1
8	AFDB:A0A060XSD9	0.508	0.461	3.036E-10	201	0.511	0.463	A0A060XSD9.pdb.gz	A0A060XSD9_ONCMY Troponin I, skeletal, slow c OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049579001 PE=4 SV=1
9	AFDB:P08057	0.497	0.430	2.627E-9	212	0.538	0.462	P08057.pdb.gz	TNNI3_BOVIN Troponin I, cardiac muscle OS=Bos taurus OX=9913 GN=TNNI3 PE=1 SV=2
10	AFDB:A0A060W984	0.511	0.357	4.276E-9	262	0.484	0.336	A0A060W984.pdb.gz	A0A060W984_ONCMY Troponin I2, fast skeletal type OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065897001 PE=4 SV=1
11	PDB:7utlV	0.516	0.550	5.100E-8	170	0.549	0.588	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
12	PDB:6lss4	0.119	0.045	6.010	620	0.126	0.037	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
13	PDB:7sqkH	0.179	0.165	6.908	201	0.181	0.164	7sqkH.pdb.gz
14	PDB:6qdvP	0.132	0.184	7.406	106	0.104	0.179	6qdvP.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
15	PDB:4aj5T	0.254	0.408	8.512	110	0.132	0.218	4aj5T.pdb.gz
16	PDB:7enah	0.138	0.135	8.512	190	0.093	0.089	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:7lguA	0.093	0.032	9.125	680	0.044	0.012	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P48788	2.65e-132	369	182	1.000	1.000	TNNI2_HUMAN Troponin I, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNI2 PE=1 SV=2
2	P27768	1.64e-130	365	182	0.978	0.978	TNNI2_RAT Troponin I, fast skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni2 PE=1 SV=2
3	P02643	2.88e-128	359	182	0.962	0.962	TNNI2_RABIT Troponin I, fast skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI2 PE=1 SV=3
4	Q0D2W2	3.45e-72	217	176	0.571	0.591	Q0D2W2_DANRE Fast muscle troponin I OS=Danio rerio OX=7955 GN=hm:zehn0173 PE=1 SV=1
5	A0A060X4F4	9.28e-71	214	178	0.582	0.596	A0A060X4F4_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023684001 PE=4 SV=1
6	Q5PR62	2.19e-69	210	182	0.577	0.577	Q5PR62_DANRE Troponin I type 1b (Skeletal, slow) OS=Danio rerio OX=7955 GN=zgc:103458 PE=1 SV=1
7	D5M8S7	2.98e-68	207	189	0.582	0.561	D5M8S7_ONCMY Cardiac troponin I OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
8	A0A060W3E5	1.66e-67	205	178	0.582	0.596	A0A060W3E5_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065901001 PE=4 SV=1
9	A0A060VX54	9.49e-67	205	221	0.555	0.457	A0A060VX54_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00080162001 PE=4 SV=1
10	Q9WUZ5	3.69e-63	194	187	0.577	0.561	TNNI1_MOUSE Troponin I, slow skeletal muscle OS=Mus musculus OX=10090 GN=Tnni1 PE=1 SV=3
11	P13413	4.49e-63	194	187	0.577	0.561	TNNI1_RAT Troponin I, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni1 PE=1 SV=2
12	P19237	7.92e-63	194	187	0.582	0.567	TNNI1_HUMAN Troponin I, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNI1 PE=1 SV=3
13	P08057	2.08e-61	191	212	0.560	0.481	TNNI3_BOVIN Troponin I, cardiac muscle OS=Bos taurus OX=9913 GN=TNNI3 PE=1 SV=2
14	P23693	2.01e-58	183	211	0.538	0.464	TNNI3_RAT Troponin I, cardiac muscle OS=Rattus norvegicus OX=10116 GN=Tnni3 PE=1 SV=2
15	P48787	4.12e-58	182	211	0.538	0.464	TNNI3_MOUSE Troponin I, cardiac muscle OS=Mus musculus OX=10090 GN=Tnni3 PE=1 SV=2
16	P02646	4.16e-58	182	211	0.549	0.474	TNNI3_RABIT Troponin I, cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI3 PE=1 SV=2
17	A0A060XSD9	2.70e-57	180	201	0.516	0.468	A0A060XSD9_ONCMY Troponin I, skeletal, slow c OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049579001 PE=4 SV=1
18	P19429	1.38e-56	179	210	0.478	0.414	TNNI3_HUMAN Troponin I, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNI3 PE=1 SV=3
19	Q6FGX2	1.38e-56	179	210	0.478	0.414	Q6FGX2_HUMAN Troponin I, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNI3 PE=1 SV=1
20	A0A060Y5I6	5.87e-51	162	148	0.434	0.534	A0A060Y5I6_ONCMY Troponin I type 1a (skeletal, slow) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00003364001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10303 DUF2408	19	17.3	Protein of unknown function (DUF2408)
2	PF06034 DUF919	59	14.9	Nucleopolyhedrovirus protein of unknown function (DUF919)
3	PF06009 Laminin_II	1.1e+02	14.2	Laminin Domain II
4	PF05478 Prominin	3.5e+02	10.6	Prominin
5	PF16740 SKA2	9.2e+02	11.0	Spindle and kinetochore-associated protein 2
6	PF00992 Troponin	7e-46	167.2	Troponin
7	PF08581 Tup_N	21	16.9	Tup N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371331

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278317	0.999	Troponin T, fast skeletal muscle
2	9606.ENSP00000361636	0.999	Troponin C, skeletal muscle
3	9606.ENSP00000232975	0.998	Troponin C, slow skeletal and cardiac muscles
4	9606.ENSP00000467176	0.993	Troponin T, slow skeletal muscle
5	9606.ENSP00000236918	0.986	Troponin T, cardiac muscle
6	9606.ENSP00000307280	0.976	Myosin light chain 1/3, skeletal muscle isoform
7	9606.ENSP00000325239	0.950	Myosin light chain, phosphorylatable, fast skeletal muscle
8	9606.ENSP00000367542	0.942	Tropomyosin beta chain
9	9606.ENSP00000400908	0.913	Myosin-binding protein C, slow-type
10	9606.ENSP00000354488	0.911	Troponin I, slow skeletal muscle
11	9606.ENSP00000341838	0.910	Troponin I, cardiac muscle
12	9606.ENSP00000464317	0.890	Myosin-3
13	9606.ENSP00000422007	0.888	Alpha-actinin-3
14	9606.ENSP00000349595	0.887	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
15	9606.ENSP00000379210	0.871	Myosin light chain 3
16	9606.ENSP00000351022	0.869	Tropomyosin alpha-1 chain
17	9606.ENSP00000350332	0.867	Myosin-binding protein C, fast-type
18	9606.ENSP00000384330	0.866	Myosin-8
19	9606.ENSP00000386041	0.856	Myosin-6
20	9606.ENSP00000347055	0.854	Myosin light chain 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0031014	0.948	troponin T binding
GO:0003779	0.664	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.987	multicellular organismal process
GO:0065007	0.982	biological regulation
GO:0050789	0.966	regulation of biological process
GO:0006937	0.893	regulation of muscle contraction
GO:0003012	0.823	muscle system process
GO:0006936	0.714	muscle contraction
GO:0050879	0.704	multicellular organismal movement
GO:0048856	0.608	anatomical structure development
GO:0050794	0.544	regulation of cellular process
GO:0009987	0.525	cellular process
GO:0006941	0.506	striated muscle contraction
GO:0050905	0.381	neuromuscular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036379	1.000	myofilament
GO:0032991	0.995	protein-containing complex
GO:0030017	0.994	sarcomere
GO:0015629	0.988	actin cytoskeleton
GO:0005865	0.966	striated muscle thin filament
GO:0005829	0.956	cytosol
GO:0005861	0.920	troponin complex
GO:0043227	0.882	membrane-bounded organelle
GO:0043231	0.601	intracellular membrane-bounded organelle
GO:0005634	0.571	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]