StarFunc result for job id P48995

User Input

>input (793 residues)
MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY
YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDS
EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK
QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL
SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL
LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF
WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF
HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF
LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS
LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW
KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW
RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG
FRTSKYAMFYPRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48995	1.000	1.000	1.702E-92	793	1.000	1.000	P48995.pdb.gz	TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens OX=9606 GN=TRPC1 PE=1 SV=1
2	AFDB:C0JJ14	0.846	0.882	1.163E-80	760	0.955	0.996	C0JJ14.pdb.gz	C0JJ14_PIG Short transient receptor potential channel 1 OS=Sus scrofa OX=9823 GN=TRPC1 PE=2 SV=1
3	AFDB:Q9PRI8	0.944	0.962	2.851E-79	778	0.870	0.887	Q9PRI8.pdb.gz	Q9PRI8_XENLA Short transient receptor potential channel 1 OS=Xenopus laevis OX=8355 GN=trpc1.L PE=2 SV=1
4	AFDB:E1U7G1	0.932	0.928	4.228E-76	796	0.816	0.813	E1U7G1.pdb.gz	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
5	AFDB:O35119	0.874	0.714	4.191E-52	977	0.451	0.366	O35119.pdb.gz	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
6	AFDB:A0A0R4IM91	0.877	0.764	2.967E-51	915	0.455	0.395	A0A0R4IM91.pdb.gz	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
7	AFDB:Q9QX29	0.883	0.723	3.081E-51	975	0.444	0.361	Q9QX29.pdb.gz	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
8	PDB:7b0jA	0.799	0.924	5.364E-45	682	0.435	0.506	7b0jA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
9	AFDB:Q9VJJ7	0.846	0.602	3.419E-44	1128	0.387	0.272	Q9VJJ7.pdb.gz	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
10	AFDB:P48994	0.836	0.598	2.813E-43	1124	0.356	0.251	P48994.pdb.gz	TRPL_DROME Transient-receptor-potential-like protein OS=Drosophila melanogaster OX=7227 GN=trpl PE=1 SV=2
11	PDB:7b1gA	0.807	0.922	8.634E-43	691	0.439	0.504	7b1gA.pdb.gz	Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
12	AFDB:Q9Y210	0.809	0.694	2.973E-40	931	0.362	0.308	Q9Y210.pdb.gz	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
13	PDB:6ysnA	0.691	0.897	5.086E-37	606	0.382	0.500	6ysnA.pdb.gz	Human TRPC5 structures reveal interaction of a xanthine-based TRPC1/4/5 inhibitor with a conserved lipid binding site.
14	PDB:7dxgA	0.746	0.841	4.005E-35	698	0.339	0.385	7dxgA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
15	PDB:7dxbA	0.765	0.819	7.543E-34	738	0.335	0.360	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
16	PDB:6uz8A	0.761	0.818	2.516E-33	734	0.343	0.371	6uz8A.pdb.gz	Structural basis for pharmacological modulation of the TRPC6 channel.
17	PDB:5yx9A	0.720	0.837	6.561E-30	675	0.342	0.401	5yx9A.pdb.gz
18	PDB:5zbgA	0.739	0.867	6.813E-30	670	0.327	0.387	5zbgA.pdb.gz
19	PDB:5vkqA	0.469	0.264	1.837E-14	1499	0.154	0.081	5vkqA.pdb.gz
20	PDB:6co7A	0.462	0.356	1.619E-12	1061	0.149	0.111	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K149	0.0	672	962	0.445	0.367	A0A0G2K149_RAT Transient receptor potential cation channel, subfamily C, member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=4 SV=2
2	A0A0R4IM91	0.0	676	915	0.465	0.403	A0A0R4IM91_DANRE Transient receptor potential cation channel, subfamily C, member 4b OS=Danio rerio OX=7955 GN=trpc4a PE=4 SV=1
3	C0JJ14	0.0	1555	760	0.955	0.996	C0JJ14_PIG Short transient receptor potential channel 1 OS=Sus scrofa OX=9823 GN=TRPC1 PE=2 SV=1
4	E1U7G1	0.0	1367	796	0.831	0.828	E1U7G1_DANRE Short transient receptor potential channel 1 OS=Danio rerio OX=7955 GN=trpc1 PE=2 SV=1
5	O35119	0.0	657	977	0.464	0.377	TRPC4_RAT Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2
6	P48995	0.0	1648	793	1.000	1.000	TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens OX=9606 GN=TRPC1 PE=1 SV=1
7	Q61056	0.0	1644	793	0.997	0.997	TRPC1_MOUSE Short transient receptor potential channel 1 OS=Mus musculus OX=10090 GN=Trpc1 PE=1 SV=5
8	Q8VD38	0.0	682	974	0.448	0.364	Q8VD38_RAT Transient receptor potential cation channel subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Trpc5 PE=2 SV=1
9	Q9PRI8	0.0	1450	778	0.878	0.895	Q9PRI8_XENLA Short transient receptor potential channel 1 OS=Xenopus laevis OX=8355 GN=trpc1.L PE=2 SV=1
10	Q9QUQ5	0.0	657	974	0.464	0.378	TRPC4_MOUSE Short transient receptor potential channel 4 OS=Mus musculus OX=10090 GN=Trpc4 PE=1 SV=1
11	Q9QX01	0.0	1550	759	0.948	0.991	TRPC1_RAT Short transient receptor potential channel 1 OS=Rattus norvegicus OX=10116 GN=Trpc1 PE=1 SV=1
12	Q9QX29	0.0	681	975	0.448	0.364	TRPC5_MOUSE Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2
13	Q9UBN4	0.0	657	977	0.467	0.379	TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens OX=9606 GN=TRPC4 PE=1 SV=1
14	Q9UL62	0.0	676	973	0.449	0.366	TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1
15	Q9VJJ7	0.0	580	1128	0.398	0.280	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
16	U3N7D8	0.0	675	915	0.465	0.403	U3N7D8_DANRE Transient receptor potential cation channel subfamily c member 4a OS=Danio rerio OX=7955 GN=trpc4a PE=1 SV=1
17	P48994	2.43e-153	478	1124	0.359	0.254	TRPL_DROME Transient-receptor-potential-like protein OS=Drosophila melanogaster OX=7227 GN=trpl PE=1 SV=2
18	Q61143	2.95e-147	457	930	0.366	0.312	TRPC6_MOUSE Short transient receptor potential channel 6 OS=Mus musculus OX=10090 GN=Trpc6 PE=1 SV=3
19	Q9Y210	5.44e-147	456	931	0.363	0.309	TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1
20	Q99N78	3.70e-146	454	930	0.367	0.313	Q99N78_RAT Transient receptor potential Ca2+ channel 6A OS=Rattus norvegicus OX=10116 GN=Trpc6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12796 Ank_2	0.012	27.5	Ankyrin repeats (3 copies)
2	PF13637 Ank_4	0.072	25.0	Ankyrin repeats (many copies)
3	PF00520 Ion_trans	3.4e-13	61.0	Ion transport protein
4	PF08344 TRP_2	1.5e-21	87.7	Transient receptor ion channel II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007508

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007138	0.932	May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity
2	60711.ENSCSAP00000013878	0.929	Uncharacterized protein
3	60711.ENSCSAP00000004929	0.925	Transient receptor potential cation channel, subfamily C, member 5
4	60711.ENSCSAP00000000604	0.906	Stromal interaction molecule 1
5	60711.ENSCSAP00000000651	0.883	Polycystin 2, transient receptor potential cation channel
6	60711.ENSCSAP00000015316	0.880	Transient receptor potential cation channel, subfamily V, member 4
7	60711.ENSCSAP00000014440	0.877	Tyrosinase
8	60711.ENSCSAP00000005896	0.871	Inositol 1,4,5-trisphosphate receptor, type 3
9	60711.ENSCSAP00000007155	0.858	Inositol 1,4,5-trisphosphate receptor, type 1
10	60711.ENSCSAP00000008058	0.840	Calcium channel, voltage-dependent, T type, alpha 1H subunit
11	60711.ENSCSAP00000009773	0.833	Belongs to the transient receptor (TC 1.A.4) family.
12	60711.ENSCSAP00000001777	0.830	Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This channel gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. [...]
13	60711.ENSCSAP00000002389	0.820	Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This channel gives rise to T-type calcium currents. T-type calcium channels belong to the "low-voltage activated (LVA)" group and are strongly blocked by nickel and mibefradil. A particularity of this type of channels is an opening at quite negative potentials, and a voltage-dependent inactivation. [...]
14	60711.ENSCSAP00000006711	0.816	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
15	60711.ENSCSAP00000004253	0.807	Transient receptor potential cation channel, subfamily M, member 6
16	60711.ENSCSAP00000005072	0.794	Transient receptor potential cation channel, subfamily V, member 2
17	60711.ENSCSAP00000007197	0.786	Transient receptor potential cation channel, subfamily M, member 7
18	60711.ENSCSAP00000015837	0.781	ORAI calcium release-activated calcium modulator 1
19	60711.ENSCSAP00000015390	0.775	Transient receptor potential cation channel, subfamily M, member 4
20	60711.ENSCSAP00000012782	0.772	Stromal interaction molecule 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005262	1.000	calcium channel activity
GO:0043167	0.749	ion binding
GO:0036094	0.713	small molecule binding
GO:0043168	0.701	anion binding
GO:0015279	0.460	store-operated calcium channel activity
GO:0043178	0.329	alcohol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0032501	0.978	multicellular organismal process
GO:0065007	0.972	biological regulation
GO:0050896	0.972	response to stimulus
GO:0006810	0.958	transport
GO:0050789	0.951	regulation of biological process
GO:0050794	0.887	regulation of cellular process
GO:0048518	0.821	positive regulation of biological process
GO:0048856	0.807	anatomical structure development
GO:0071840	0.785	cellular component organization or biogenesis
GO:0003008	0.777	system process
GO:0007275	0.768	multicellular organism development
GO:0016043	0.766	cellular component organization
GO:0065008	0.754	regulation of biological quality
GO:0042221	0.703	response to chemical
GO:0048731	0.698	system development
GO:0006811	0.660	monoatomic ion transport
GO:0051716	0.623	cellular response to stimulus
GO:0048519	0.611	negative regulation of biological process
GO:0022607	0.603	cellular component assembly
GO:0051239	0.559	regulation of multicellular organismal process
GO:0006816	0.557	calcium ion transport
GO:0055085	0.548	transmembrane transport
GO:0046847	0.546	filopodium assembly
GO:0098662	0.529	inorganic cation transmembrane transport
GO:0098655	0.528	monoatomic cation transmembrane transport
GO:0001570	0.523	vasculogenesis
GO:0070588	0.498	calcium ion transmembrane transport
GO:0048522	0.444	positive regulation of cellular process
GO:0044057	0.432	regulation of system process
GO:0006950	0.427	response to stress
GO:0046903	0.362	secretion
GO:0048646	0.361	anatomical structure formation involved in morphogenesis
GO:0032879	0.333	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.928	protein-containing complex
GO:0005622	0.831	intracellular anatomical structure
GO:0005737	0.810	cytoplasm
GO:0043229	0.371	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]