StarFunc result for job id P49023

User Input

>input (591 residues)
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSF
PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPL
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJQ8	0.514	0.514	4.015E-95	591	1.000	1.000	A0A140VJQ8.pdb.gz	A0A140VJQ8_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=2 SV=1
2	AFDB:P49024	0.550	0.580	2.648E-86	559	0.851	0.900	P49024.pdb.gz	PAXI_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=1 SV=1
3	AFDB:O60711	0.368	0.533	1.499E-46	386	0.350	0.536	O60711.pdb.gz	LPXN_HUMAN Leupaxin OS=Homo sapiens OX=9606 GN=LPXN PE=1 SV=1
4	AFDB:Q99N69	0.392	0.578	7.149E-45	386	0.357	0.547	Q99N69.pdb.gz	LPXN_MOUSE Leupaxin OS=Mus musculus OX=10090 GN=Lpxn PE=1 SV=2
5	AFDB:Q8MML5	0.413	0.428	1.017E-36	569	0.318	0.330	Q8MML5.pdb.gz	PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum OX=44689 GN=paxB PE=2 SV=1
6	AFDB:Q966T5	0.295	0.819	6.956E-31	197	0.223	0.670	Q966T5.pdb.gz	Q966T5_DROME Paxillin, isoform D OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
7	AFDB:Q9VY77	0.235	0.195	2.318E-18	728	0.203	0.165	Q9VY77.pdb.gz	AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster OX=7227 GN=jub PE=1 SV=3
8	AFDB:Q9UGP4	0.250	0.223	1.142E-17	676	0.184	0.161	Q9UGP4.pdb.gz	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
9	AFDB:Q4ZGL5	0.256	0.254	2.867E-17	596	0.205	0.203	Q4ZGL5.pdb.gz
10	AFDB:Q9QXD8	0.279	0.252	1.920E-16	668	0.183	0.162	Q9QXD8.pdb.gz	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
11	PDB:4kfzB	0.108	0.357	7.633E-9	148	0.054	0.216	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.104	0.302	1.278E-5	192	0.066	0.203	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.090	0.561	1.354E-3	76	0.030	0.237	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4kblA	0.078	0.107	4.069E-1	395	0.049	0.073	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
15	PDB:7zsb4	0.054	0.093	1.569	306	0.019	0.036	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:7od1A	0.057	0.073	1.668	430	0.058	0.079	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:7a1gM	0.047	0.401	2.005	53	0.012	0.132	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
18	PDB:5gm6a	0.049	0.183	2.267	123	0.037	0.179	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:2ajqA	0.039	0.034	3.276	704	0.032	0.027	2ajqA.pdb.gz	Structure of replicative DNA polymerase provides insigts into the mechanisms for processivity, frameshifting and editing
20	PDB:7oniH	0.052	0.079	3.483	380	0.015	0.024	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJQ8	0.0	1224	591	1.000	1.000	A0A140VJQ8_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=2 SV=1
2	A0A1B0GTU4	0.0	663	1081	0.531	0.290	A0A1B0GTU4_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
3	F1MFD1	0.0	1075	586	0.926	0.933	F1MFD1_BOVIN Paxillin OS=Bos taurus OX=9913 GN=PXN PE=1 SV=3
4	F1NB68	0.0	981	557	0.843	0.894	F1NB68_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=3 SV=4
5	F5GZ78	0.0	1216	589	0.993	0.997	F5GZ78_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=1
6	G1N9N2	0.0	988	557	0.849	0.901	G1N9N2_MELGA Paxillin OS=Meleagris gallopavo OX=9103 GN=PXN PE=3 SV=2
7	P49023	0.0	1224	591	1.000	1.000	PAXI_HUMAN Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3
8	P49024	0.0	968	559	0.832	0.880	PAXI_CHICK Paxillin OS=Gallus gallus OX=9031 GN=PXN PE=1 SV=1
9	Q66H76	0.0	991	586	0.873	0.881	PAXI_RAT Paxillin OS=Rattus norvegicus OX=10116 GN=Pxn PE=1 SV=1
10	Q6R3L1	0.0	770	533	0.672	0.745	Q6R3L1_DANRE Paxillin OS=Danio rerio OX=7955 GN=pxn PE=1 SV=1
11	Q8VI36	0.0	1085	591	0.919	0.919	PAXI_MOUSE Paxillin OS=Mus musculus OX=10090 GN=Pxn PE=1 SV=1
12	Q8MQX3	1.04e-163	480	557	0.428	0.454	Q8MQX3_DROME SD04793p OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=1
13	Q9BPQ9	1.53e-163	481	581	0.428	0.435	Q9BPQ9_DROME Paxillin OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=2
14	Q8INW7	1.70e-163	479	557	0.428	0.454	Q8INW7_DROME FI11475p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
15	Q9VIX3	1.75e-163	479	556	0.428	0.455	Q9VIX3_DROME Paxillin, isoform B OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=2
16	D3DMM0	2.04e-163	479	563	0.428	0.449	D3DMM0_DROME MIP15702p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
17	Q9VIX2	2.36e-163	480	581	0.428	0.435	Q9VIX2_DROME LD06038p OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=3
18	Q2PDT4	4.87e-163	479	581	0.428	0.435	Q2PDT4_DROME Paxillin, isoform F OS=Drosophila melanogaster OX=7227 GN=Pax PE=1 SV=1
19	Q9GSE0	6.66e-163	478	556	0.430	0.457	Q9GSE0_DROME Focal contact protein paxillin OS=Drosophila melanogaster OX=7227 GN=Pax PE=2 SV=1
20	O60711	2.02e-145	427	386	0.347	0.531	LPXN_HUMAN Leupaxin OS=Homo sapiens OX=9606 GN=LPXN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08796 DUF1797	3.8e+02	12.5	Protein of unknown function (DUF1797)
2	PF00412 LIM	4.9e-63	220.5	LIM domain
3	PF03535 Paxillin	1e-90	314.6	Paxillin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000009381

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000035264	0.999	Belongs to the protein kinase superfamily. Tyr protein kinase family
2	9598.ENSPTRP00000005889	0.998	Uncharacterized protein
3	9598.ENSPTRP00000034416	0.998	PTK2B protein tyrosine kinase 2 beta
4	9598.ENSPTRP00000059492	0.997	G protein-coupled receptor kinase interacting ArfGAP 1
5	9598.ENSPTRP00000014539	0.996	CRK proto-oncogene, adaptor protein
6	9598.ENSPTRP00000004598	0.995	Vinculin
7	9598.ENSPTRP00000005773	0.994	Integrin-linked kinase
8	9598.ENSPTRP00000059565	0.994	Uncharacterized protein
9	9598.ENSPTRP00000023137	0.991	Tyrosine-protein kinase
10	9598.ENSPTRP00000044327	0.990	G protein-coupled receptor kinase interacting ArfGAP 2
11	9598.ENSPTRP00000058206	0.989	Parvin, beta
12	9598.ENSPTRP00000004110	0.988	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
13	9598.ENSPTRP00000010269	0.988	Rho guanine nucleotide exchange factor (GEF) 7
14	9598.ENSPTRP00000046677	0.988	Uncharacterized protein
15	9598.ENSPTRP00000021717	0.980	Integrin, alpha 4 (Antigen CD49D, alpha 4 subunit of VLA-4 receptor)
16	9598.ENSPTRP00000012464	0.961	Tyrosine-protein kinase
17	9598.ENSPTRP00000025436	0.961	Belongs to the integrin alpha chain family.
18	9598.ENSPTRP00000056703	0.961	Talin 1
19	9598.ENSPTRP00000027639	0.958	Uncharacterized protein
20	9598.ENSPTRP00000025759	0.938	Ras homolog family member A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0008092	0.929	cytoskeletal protein binding
GO:0017166	0.822	vinculin binding
GO:0019899	0.424	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0050896	0.967	response to stimulus
GO:0009987	0.966	cellular process
GO:0050794	0.935	regulation of cellular process
GO:0051716	0.859	cellular response to stimulus
GO:0023052	0.839	signaling
GO:0007167	0.831	enzyme-linked receptor protein signaling pathway
GO:0065009	0.815	regulation of molecular function
GO:0042221	0.800	response to chemical
GO:0009719	0.718	response to endogenous stimulus
GO:0032501	0.716	multicellular organismal process
GO:0010033	0.694	response to organic substance
GO:0071495	0.693	cellular response to endogenous stimulus
GO:0010243	0.679	response to organonitrogen compound
GO:1901700	0.676	response to oxygen-containing compound
GO:0007178	0.663	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048856	0.646	anatomical structure development
GO:0071363	0.635	cellular response to growth factor stimulus
GO:1901652	0.589	response to peptide
GO:0071840	0.513	cellular component organization or biogenesis
GO:0016043	0.464	cellular component organization
GO:0048518	0.461	positive regulation of biological process
GO:0048522	0.415	positive regulation of cellular process
GO:0007275	0.388	multicellular organism development
GO:0009653	0.371	anatomical structure morphogenesis
GO:0051098	0.316	regulation of binding
GO:0071704	0.311	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	0.998	focal adhesion
GO:0005829	0.995	cytosol
GO:0071944	0.977	cell periphery
GO:0005886	0.974	plasma membrane
GO:0043226	0.922	organelle
GO:0043229	0.907	intracellular organelle
GO:0043227	0.781	membrane-bounded organelle
GO:0043232	0.742	intracellular non-membrane-bounded organelle
GO:0043231	0.713	intracellular membrane-bounded organelle
GO:0015629	0.403	actin cytoskeleton
GO:0005634	0.386	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]