StarFunc result for job id P49069

User Input

>input (296 residues)
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEE
SQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKP
PECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGN
TTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKT
TVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49069	1.000	1.000	1.802E-38	296	1.000	1.000	P49069.pdb.gz	CAMLG_HUMAN Guided entry of tail-anchored proteins factor CAMLG OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1
2	AFDB:Q6DGG9	0.681	0.683	4.282E-31	295	0.865	0.868	Q6DGG9.pdb.gz	CAMLG_RAT Guided entry of tail-anchored proteins factor CAMLG OS=Rattus norvegicus OX=10116 GN=Camlg PE=1 SV=1
3	AFDB:Q8N8D1	0.134	0.090	4.205E-1	485	0.135	0.082	Q8N8D1.pdb.gz	PDCD7_HUMAN Programmed cell death protein 7 OS=Homo sapiens OX=9606 GN=PDCD7 PE=1 SV=1
4	AFDB:Q6IFV1	0.123	0.081	5.652E-1	485	0.149	0.091	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
5	AFDB:Q921M4	0.141	0.045	5.997E-1	999	0.142	0.042	Q921M4.pdb.gz	GOGA2_MOUSE Golgin subfamily A member 2 OS=Mus musculus OX=10090 GN=Golga2 PE=1 SV=3
6	AFDB:Q6GQV0	0.139	0.104	6.362E-1	436	0.139	0.094	Q6GQV0.pdb.gz	TEDC2_MOUSE Tubulin epsilon and delta complex protein 2 OS=Mus musculus OX=10090 GN=Tedc2 PE=1 SV=1
7	AFDB:O74360	0.140	0.050	6.750E-1	933	0.149	0.047	O74360.pdb.gz	RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga4 PE=1 SV=2
8	AFDB:Q92376	0.141	0.059	7.162E-1	832	0.115	0.041	Q92376.pdb.gz	KLP1_SCHPO Kinesin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp1 PE=2 SV=2
9	AFDB:Q80Y83	0.143	0.063	7.598E-1	711	0.159	0.066	Q80Y83.pdb.gz	DIXC1_MOUSE Dixin OS=Mus musculus OX=10090 GN=Dixdc1 PE=1 SV=1
10	AFDB:P38236	0.129	0.105	1.084	366	0.172	0.139	P38236.pdb.gz	FL2D_YEAST Protein MUM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MUM2 PE=1 SV=1
11	PDB:7o4i1	0.135	0.089	1.438	522	0.078	0.044	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
12	PDB:6elzt	0.183	0.186	2.309	290	0.030	0.031	6elzt.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
13	PDB:6mdmH	0.163	0.280	2.758	147	0.068	0.136	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
14	PDB:7xowR	0.116	0.122	2.758	276	0.051	0.054	7xowR.pdb.gz	Structural insights into human brain-gut peptide cholecystokinin receptors.
15	PDB:6zgdA	0.160	0.163	3.494	288	0.037	0.038	6zgdA.pdb.gz
16	PDB:6z3wF	0.182	0.375	3.707	110	0.044	0.118	6z3wF.pdb.gz
17	PDB:7mq8SY	0.160	0.194	4.173	238	0.068	0.084	7mq8SY.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7q83D	0.128	0.206	4.428	156	0.047	0.090	7q83D.pdb.gz
19	PDB:1kqfC	0.116	0.147	4.984	216	0.081	0.111	1kqfC.pdb.gz	Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
20	PDB:5ew5A	0.103	0.067	4.984	490	0.057	0.035	5ew5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49069	0.0	610	296	1.000	1.000	CAMLG_HUMAN Guided entry of tail-anchored proteins factor CAMLG OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1
2	P49070	0.0	537	294	0.889	0.895	CAMLG_MOUSE Guided entry of tail-anchored proteins factor CAMLG OS=Mus musculus OX=10090 GN=Camlg PE=1 SV=2
3	Q6DGG9	0.0	514	295	0.865	0.868	CAMLG_RAT Guided entry of tail-anchored proteins factor CAMLG OS=Rattus norvegicus OX=10116 GN=Camlg PE=1 SV=1
4	Q9JKY5	2.5	32.3	1068	0.135	0.037	HIP1R_MOUSE Huntingtin-interacting protein 1-related protein OS=Mus musculus OX=10090 GN=Hip1r PE=1 SV=2
5	Q6L568	4.7	30.8	237	0.071	0.089	SWET5_ORYSJ Bidirectional sugar transporter SWEET5 OS=Oryza sativa subsp. japonica OX=39947 GN=SWEET5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13850 ERGIC_N	4e+02	12.7	Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC)
2	PF14963 Get2_like	3.8e-142	484.7	Get2-like
3	PF03631 Virul_fac_BrkB	5.6e+02	11.5	Virulence factor BrkB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297156

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327716	0.999	Tail-anchored protein insertion receptor WRB
2	9606.ENSP00000466379	0.999	ATPase ASNA1
3	9606.ENSP00000261652	0.996	Tumor necrosis factor receptor superfamily member 13B
4	9606.ENSP00000265857	0.957	Golgi to ER traffic protein 4 homolog
5	9606.ENSP00000221566	0.889	Small glutamine-rich tetratricopeptide repeat-containing protein alpha
6	9606.ENSP00000358674	0.886	Ubiquitin-like protein 4A
7	9606.ENSP00000252593	0.833	Bone marrow stromal antigen 2
8	9606.ENSP00000275493	0.816	Epidermal growth factor receptor
9	9606.ENSP00000333769	0.816	Basigin
10	9606.ENSP00000365048	0.794	Tumor necrosis factor ligand superfamily member 13B
11	9606.ENSP00000319713	0.788	Type-1 angiotensin II receptor-associated protein
12	9606.ENSP00000291232	0.787	Tumor necrosis factor receptor superfamily member 13C
13	9606.ENSP00000420076	0.763	Stress-associated endoplasmic reticulum protein 1
14	9606.ENSP00000300026	0.761	Peptidyl-prolyl cis-trans isomerase B
15	9606.ENSP00000294179	0.736	Syntaxin-5
16	9606.ENSP00000341625	0.718	Cytochrome b5
17	9606.ENSP00000370395	0.680	Small glutamine-rich tetratricopeptide repeat-containing protein beta
18	9606.ENSP00000365131	0.679	Large proline-rich protein BAG6
19	9606.ENSP00000345656	0.673	Vesicle-associated membrane protein-associated protein A
20	9606.ENSP00000329915	0.668	Proteasome assembly chaperone 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.933	enzyme binding
GO:0031625	0.922	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.989	response to stimulus
GO:0023052	0.988	signaling
GO:0007154	0.987	cell communication
GO:0050789	0.986	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0061024	0.968	membrane organization
GO:0045184	0.965	establishment of protein localization
GO:0090150	0.957	establishment of protein localization to membrane
GO:0010256	0.954	endomembrane system organization
GO:0033365	0.945	protein localization to organelle
GO:0045048	0.937	protein insertion into ER membrane
GO:0051716	0.931	cellular response to stimulus
GO:0007165	0.838	signal transduction
GO:0044237	0.688	cellular metabolic process
GO:0071704	0.661	organic substance metabolic process
GO:0019222	0.630	regulation of metabolic process
GO:0043170	0.555	macromolecule metabolic process
GO:0060255	0.513	regulation of macromolecule metabolic process
GO:0051171	0.501	regulation of nitrogen compound metabolic process
GO:0006807	0.457	nitrogen compound metabolic process
GO:0044238	0.428	primary metabolic process
GO:0048519	0.419	negative regulation of biological process
GO:0080090	0.385	regulation of primary metabolic process
GO:0032501	0.367	multicellular organismal process
GO:0048518	0.356	positive regulation of biological process
GO:0071816	0.310	tail-anchored membrane protein insertion into ER membrane
GO:0006950	0.301	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140534	1.000	endoplasmic reticulum protein-containing complex
GO:0016020	0.978	membrane
GO:0031090	0.920	organelle membrane
GO:0043529	0.761	GET complex
GO:0031984	0.726	organelle subcompartment
GO:0042175	0.688	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.686	endoplasmic reticulum subcompartment
GO:0005789	0.661	endoplasmic reticulum membrane
GO:0070013	0.378	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]