StarFunc result for job id P49116

User Input

>input (596 residues)
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQ
PEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F2YGU2	0.641	0.623	4.390E-71	615	0.977	0.946	F2YGU2.pdb.gz	F2YGU2_HUMAN Nuclear receptor subfamily 2, group C, member 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=NR2C2 PE=2 SV=1
2	AFDB:Q26622	0.460	0.469	2.768E-44	583	0.500	0.511	Q26622.pdb.gz	SHR2_STRPU Orphan steroid hormone receptor 2 OS=Strongylocentrotus purpuratus OX=7668 GN=SHR2 PE=1 SV=1
3	AFDB:Q24142	0.347	0.345	1.740E-25	601	0.253	0.251	Q24142.pdb.gz	HR78_DROME Nuclear hormone receptor HR78 OS=Drosophila melanogaster OX=7227 GN=Hr78 PE=1 SV=2
4	AFDB:A1ZA01	0.393	0.401	8.750E-24	582	0.247	0.253	A1ZA01.pdb.gz	A1ZA01_DROME Hormone receptor 51 OS=Drosophila melanogaster OX=7227 GN=Hr51 PE=2 SV=2
5	AFDB:P10588	0.355	0.487	9.605E-24	404	0.252	0.371	P10588.pdb.gz	NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens OX=9606 GN=NR2F6 PE=1 SV=2
6	AFDB:F1D8R0	0.361	0.485	1.006E-23	414	0.262	0.377	F1D8R0.pdb.gz	F1D8R0_HUMAN Ovalbumin upstream promoter-transcription factor II variant 1 OS=Homo sapiens OX=9606 GN=NR2F2 PE=2 SV=1
7	AFDB:Q06726	0.324	0.467	1.006E-23	403	0.238	0.352	Q06726.pdb.gz	NR2F5_DANRE Nuclear receptor subfamily 2 group F member 5 OS=Danio rerio OX=7955 GN=nr2f5 PE=2 SV=1
8	AFDB:P10589	0.382	0.507	1.462E-23	423	0.260	0.366	P10589.pdb.gz	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
9	AFDB:Q6PH18	0.328	0.492	2.441E-23	389	0.237	0.362	Q6PH18.pdb.gz	N2F1B_DANRE Nuclear receptor subfamily 2 group F member 1-B OS=Danio rerio OX=7955 GN=nr2f1b PE=2 SV=1
10	AFDB:B3DGQ7	0.320	0.437	2.942E-23	428	0.243	0.339	B3DGQ7.pdb.gz
11	PDB:3dzyA	0.286	0.479	2.753E-15	302	0.208	0.411	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.259	0.581	2.516E-7	246	0.102	0.248	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.249	0.585	6.475E-5	238	0.062	0.155	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.239	0.503	2.281E-4	259	0.067	0.154	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:4im0A	0.049	0.048	5.018E-1	619	0.067	0.065	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
16	PDB:6qdvT	0.067	0.064	6.047E-1	639	0.044	0.041	6qdvT.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
17	PDB:7p54A	0.074	0.101	6.047E-1	397	0.059	0.088	7p54A.pdb.gz
18	PDB:7p5cA	0.062	0.086	6.638E-1	392	0.052	0.079	7p5cA.pdb.gz
19	PDB:7r5jD4	0.075	0.042	9.641E-1	1312	0.072	0.033	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:4o9yA	0.057	0.018	1.058	2490	0.057	0.014	4o9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2YGU2	0.0	1225	615	1.000	0.969	F2YGU2_HUMAN Nuclear receptor subfamily 2, group C, member 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=NR2C2 PE=2 SV=1
2	P13056	0.0	714	603	0.634	0.627	NR2C1_HUMAN Nuclear receptor subfamily 2 group C member 1 OS=Homo sapiens OX=9606 GN=NR2C1 PE=1 SV=2
3	P49116	0.0	1235	596	1.000	1.000	NR2C2_HUMAN Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1
4	P49117	0.0	1216	596	0.983	0.983	NR2C2_MOUSE Nuclear receptor subfamily 2 group C member 2 OS=Mus musculus OX=10090 GN=Nr2c2 PE=1 SV=1
5	Q26622	0.0	571	583	0.507	0.518	SHR2_STRPU Orphan steroid hormone receptor 2 OS=Strongylocentrotus purpuratus OX=7668 GN=SHR2 PE=1 SV=1
6	Q505F1	0.0	699	590	0.617	0.624	NR2C1_MOUSE Nuclear receptor subfamily 2 group C member 1 OS=Mus musculus OX=10090 GN=Nr2c1 PE=1 SV=3
7	Q6PHZ7	0.0	1030	530	0.841	0.945	Q6PHZ7_HUMAN NR2C2 protein OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1
8	A1ZA01	2.28e-50	185	582	0.248	0.254	A1ZA01_DROME Hormone receptor 51 OS=Drosophila melanogaster OX=7227 GN=Hr51 PE=2 SV=2
9	A0A1W2Q6N8	1.88e-41	153	273	0.131	0.286	A0A1W2Q6N8_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=4 SV=1
10	F1DAL9	5.65e-41	155	398	0.131	0.196	F1DAL9_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
11	A0A8I6A7N1	6.97e-41	155	398	0.131	0.196	A0A8I6A7N1_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
12	F2Z3S9	7.94e-41	155	420	0.131	0.186	F2Z3S9_RAT Nuclear receptor subfamily 2, group F, member 1 OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=3 SV=1
13	P10589	8.01e-41	155	423	0.131	0.184	COT1_HUMAN COUP transcription factor 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
14	Q60632	8.26e-41	155	422	0.131	0.185	COT1_MOUSE COUP transcription factor 1 OS=Mus musculus OX=10090 GN=Nr2f1 PE=2 SV=2
15	F1DAL7	9.41e-41	154	372	0.131	0.210	F1DAL7_HUMAN Nuclear receptor subfamily 2 group F member 1 OS=Homo sapiens OX=9606 GN=NR2F1 PE=1 SV=1
16	Q06725	9.91e-41	155	411	0.129	0.187	N2F1A_DANRE Nuclear receptor subfamily 2 group F member 1-A OS=Danio rerio OX=7955 GN=nr2f1a PE=2 SV=1
17	A0A060YH15	1.29e-40	154	391	0.129	0.197	A0A060YH15_ONCMY COUP transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037055001 PE=3 SV=1
18	Q62681	3.94e-40	153	419	0.129	0.184	Q62681_RAT Orphan receptor COUP-TFI OS=Rattus norvegicus OX=10116 GN=Nr2f1 PE=2 SV=1
19	Q91430	5.40e-40	153	422	0.126	0.178	Q91430_DANRE COUP transcription factor 2 OS=Danio rerio OX=7955 GN=svp[40] PE=1 SV=1
20	Q90733	7.40e-40	152	410	0.126	0.183	COT2_CHICK COUP transcription factor 2 OS=Gallus gallus OX=9031 GN=NR2F2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18288 FAA_hydro_N_2	5.2e+02	12.4	Fumarylacetoacetase N-terminal domain 2
2	PF00104 Hormone_recep	6.6e-39	145.2	Ligand-binding domain of nuclear hormone receptor
3	PF02186 TFIIE_beta	3.7e+02	12.8	TFIIE beta subunit core domain
4	PF00105 zf-C4	2e-28	109.9	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005460

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000013252	0.771	TGF-beta activated kinase 1/MAP3K7 binding protein 2
2	60711.ENSCSAP00000018230	0.748	Nuclear receptor interacting protein 1
3	60711.ENSCSAP00000010486	0.747	Uncharacterized protein
4	60711.ENSCSAP00000002648	0.746	TGF-beta activated kinase 1/MAP3K7 binding protein 1
5	60711.ENSCSAP00000008654	0.722	Uncharacterized protein
6	60711.ENSCSAP00000016047	0.696	Nuclear receptor corepressor 2
7	60711.ENSCSAP00000004853	0.682	Nuclear receptor corepressor 1
8	60711.ENSCSAP00000013306	0.651	Mitogen-activated protein kinase kinase kinase 7
9	60711.ENSCSAP00000007285	0.648	Receptor protein serine/threonine kinase
10	60711.ENSCSAP00000005897	0.645	Transmembrane serine/threonine kinase forming with the TGF- beta type I serine/threonine kinase receptor, TGFBR1, the non- promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of th [...]
11	60711.ENSCSAP00000000721	0.641	Belongs to the protein kinase superfamily.
12	60711.ENSCSAP00000002825	0.641	Asparaginase like 1
13	60711.ENSCSAP00000002629	0.633	Mitochondrial elongation factor 1
14	60711.ENSCSAP00000001519	0.606	Nuclear receptor 2C2-associated protein
15	60711.ENSCSAP00000015361	0.605	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
16	60711.ENSCSAP00000007972	0.594	Ubiquitin-conjugating enzyme E2I
17	60711.ENSCSAP00000017088	0.560	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
18	60711.ENSCSAP00000011772	0.541	Histone deacetylase 2
19	60711.ENSCSAP00000016053	0.537	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
20	60711.ENSCSAP00000016960	0.537	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0005515	0.999	protein binding
GO:0003700	0.995	DNA-binding transcription factor activity
GO:0003690	0.985	double-stranded DNA binding
GO:0000981	0.978	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.976	sequence-specific double-stranded DNA binding
GO:0000976	0.731	transcription cis-regulatory region binding
GO:0038023	0.541	signaling receptor activity
GO:0000977	0.478	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.399	transcription factor binding
GO:0000987	0.318	cis-regulatory region sequence-specific DNA binding
GO:0019899	0.301	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0032501	0.994	multicellular organismal process
GO:0050794	0.990	regulation of cellular process
GO:0032502	0.972	developmental process
GO:0048522	0.951	positive regulation of cellular process
GO:0019222	0.947	regulation of metabolic process
GO:0006357	0.942	regulation of transcription by RNA polymerase II
GO:0048523	0.902	negative regulation of cellular process
GO:0010604	0.819	positive regulation of macromolecule metabolic process
GO:0009987	0.812	cellular process
GO:0009890	0.783	negative regulation of biosynthetic process
GO:0010605	0.748	negative regulation of macromolecule metabolic process
GO:0048856	0.737	anatomical structure development
GO:0051253	0.723	negative regulation of RNA metabolic process
GO:0051173	0.720	positive regulation of nitrogen compound metabolic process
GO:0031325	0.720	positive regulation of cellular metabolic process
GO:0007275	0.718	multicellular organism development
GO:0048731	0.652	system development
GO:0045892	0.641	negative regulation of DNA-templated transcription
GO:0000122	0.588	negative regulation of transcription by RNA polymerase II
GO:0008152	0.464	metabolic process
GO:0050896	0.460	response to stimulus
GO:0010557	0.459	positive regulation of macromolecule biosynthetic process
GO:0045893	0.451	positive regulation of DNA-templated transcription
GO:0007399	0.415	nervous system development
GO:0023051	0.400	regulation of signaling
GO:0010646	0.399	regulation of cell communication
GO:0071704	0.392	organic substance metabolic process
GO:0048583	0.385	regulation of response to stimulus
GO:0044237	0.379	cellular metabolic process
GO:0051716	0.352	cellular response to stimulus
GO:0045944	0.328	positive regulation of transcription by RNA polymerase II
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]