StarFunc result for job id P49137

User Input

>input (400 residues)
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49137	1.000	1.000	2.640E-72	400	1.000	1.000	P49137.pdb.gz	MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 PE=1 SV=1
2	AFDB:Q7T2F2	0.848	0.886	7.834E-59	382	0.792	0.830	Q7T2F2.pdb.gz	Q7T2F2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=mapkapk2 PE=1 SV=1
3	AFDB:Q3UMW7	0.846	0.881	2.637E-52	384	0.627	0.654	Q3UMW7.pdb.gz	MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapkapk3 PE=1 SV=2
4	PDB:6tcaA	0.777	0.896	4.152E-52	345	0.858	0.994	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.
5	AFDB:P49071	0.849	0.945	3.783E-47	359	0.542	0.604	P49071.pdb.gz	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
6	AFDB:Q965G5	0.793	0.865	3.752E-44	366	0.490	0.536	Q965G5.pdb.gz	MAK2_CAEEL MAP kinase-activated protein kinase mak-2 OS=Caenorhabditis elegans OX=6239 GN=mak-2 PE=1 SV=2
7	AFDB:O54992	0.742	0.632	1.253E-34	473	0.380	0.321	O54992.pdb.gz	MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus OX=10090 GN=Mapkapk5 PE=1 SV=1
8	AFDB:Q21360	0.723	0.563	1.917E-33	521	0.385	0.296	Q21360.pdb.gz	MAK1_CAEEL MAP kinase-activated protein kinase mak-1 OS=Caenorhabditis elegans OX=6239 GN=mak-1 PE=1 SV=1
9	AFDB:Q15418	0.660	0.375	1.223E-25	735	0.310	0.169	Q15418.pdb.gz	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
10	AFDB:Q8I113	0.604	0.352	1.979E-25	707	0.292	0.165	Q8I113.pdb.gz	MNK_CAEEL MAP kinase-interacting serine/threonine-protein kinase mnk-1 OS=Caenorhabditis elegans OX=6239 GN=mnk-1 PE=2 SV=2
11	AFDB:O75582	0.676	0.351	5.767E-25	802	0.263	0.131	O75582.pdb.gz	KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens OX=9606 GN=RPS6KA5 PE=1 SV=1
12	PDB:5u6yA	0.585	0.514	5.289E-23	459	0.250	0.218	5u6yA.pdb.gz
13	PDB:8bfsA	0.577	0.821	1.173E-20	274	0.247	0.361	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
14	PDB:2yaaA	0.610	0.801	8.047E-20	300	0.245	0.327	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:3soaA	0.582	0.537	1.109E-19	436	0.247	0.227	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
16	PDB:6b1uA	0.525	0.477	7.191E-18	442	0.242	0.219	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4zhxA	0.528	0.517	8.003E-18	409	0.240	0.235	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:6byrA	0.511	0.505	2.461E-17	405	0.235	0.232	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
19	PDB:4rerA	0.528	0.463	6.108E-17	459	0.245	0.214	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:5ufuA	0.533	0.575	7.566E-17	369	0.212	0.230	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49137	0.0	833	400	1.000	1.000	MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens OX=9606 GN=MAPKAPK2 PE=1 SV=1
2	P49138	0.0	728	386	0.865	0.896	MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus OX=10090 GN=Mapkapk2 PE=1 SV=2
3	Q16644	0.0	547	382	0.635	0.665	MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPKAPK3 PE=1 SV=1
4	Q3UMW7	0.0	541	384	0.627	0.654	MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapkapk3 PE=1 SV=2
5	Q7T2F2	0.0	650	382	0.760	0.796	Q7T2F2_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=mapkapk2 PE=1 SV=1
6	P49071	5.91e-170	481	359	0.542	0.604	MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster OX=7227 GN=MAPk-Ak2 PE=2 SV=1
7	Q965G5	7.80e-144	415	366	0.487	0.533	MAK2_CAEEL MAP kinase-activated protein kinase mak-2 OS=Caenorhabditis elegans OX=6239 GN=mak-2 PE=1 SV=2
8	Q21360	1.32e-100	310	521	0.390	0.299	MAK1_CAEEL MAP kinase-activated protein kinase mak-1 OS=Caenorhabditis elegans OX=6239 GN=mak-1 PE=1 SV=1
9	O54992	3.00e-90	282	473	0.385	0.326	MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus OX=10090 GN=Mapkapk5 PE=1 SV=1
10	Q8IW41	1.99e-89	280	473	0.383	0.323	MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens OX=9606 GN=MAPKAPK5 PE=1 SV=2
11	Q8ICR0	1.15e-62	211	513	0.290	0.226	CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CDPK2 PE=1 SV=4
12	Q6P965	1.18e-60	204	433	0.270	0.249	Q6P965_DANRE Calcium/calmodulin-dependent protein kinase IG OS=Danio rerio OX=7955 GN=zgc:73155 PE=2 SV=1
13	F1QB46	1.37e-60	204	433	0.270	0.249	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
14	E9PGT3	7.24e-60	208	724	0.280	0.155	E9PGT3_HUMAN Ribosomal protein S6 kinase OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=1
15	Q15418	8.11e-60	208	735	0.268	0.146	KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2
16	Q63450	5.64e-59	198	374	0.265	0.283	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
17	Q91YS8	6.27e-59	198	374	0.265	0.283	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1
18	Q14012	8.02e-59	197	370	0.265	0.286	KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1
19	P18653	1.06e-58	205	724	0.268	0.148	KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus OX=10090 GN=Rps6ka1 PE=1 SV=1
20	E7F1H0	1.22e-58	197	382	0.270	0.283	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01633 Choline_kinase	3.1e+02	12.4	Choline/ethanolamine kinase
2	PF06293 Kdo	0.009	27.0	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF14531 Kinase-like	0.34	21.8	Kinase-like
4	PF00069 Pkinase	6.5e-65	230.7	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	1.7e-25	101.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229795	0.999	Mitogen-activated protein kinase 14
2	9606.ENSP00000248553	0.998	Heat shock protein beta-1
3	9606.ENSP00000333685	0.986	Mitogen-activated protein kinase 11
4	9606.ENSP00000363512	0.972	Arachidonate 5-lipoxygenase
5	9606.ENSP00000469647	0.971	mRNA decay activator protein ZFP36
6	9606.ENSP00000388402	0.965	mRNA decay activator protein ZFP36L1
7	9606.ENSP00000371194	0.958	Lymphocyte-specific protein 1
8	9606.ENSP00000387699	0.954	Cyclic AMP-responsive element-binding protein 1
9	9606.ENSP00000245960	0.949	M-phase inducer phosphatase 2
10	9606.ENSP00000468348	0.949	Dual specificity mitogen-activated protein kinase kinase 6
11	9606.ENSP00000398698	0.944	Tumor necrosis factor
12	9606.ENSP00000345083	0.938	Dual specificity mitogen-activated protein kinase kinase 3
13	9606.ENSP00000379287	0.936	14-3-3 protein zeta/delta
14	9606.ENSP00000215832	0.934	Mitogen-activated protein kinase 1
15	9606.ENSP00000265354	0.934	Serum response factor
16	9606.ENSP00000219476	0.931	Tuberin
17	9606.ENSP00000431512	0.929	Heat shock factor protein 1
18	9606.ENSP00000262965	0.928	Transcription factor E2-alpha
19	9606.ENSP00000405327	0.928	ETS translocation variant 1
20	9606.ENSP00000263339	0.925	Interleukin-1 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.323	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0071704	0.986	organic substance metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0044237	0.986	cellular metabolic process
GO:0016310	0.976	phosphorylation
GO:0044238	0.972	primary metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0043412	0.968	macromolecule modification
GO:0023052	0.965	signaling
GO:0006468	0.962	protein phosphorylation
GO:0051716	0.954	cellular response to stimulus
GO:0007154	0.941	cell communication
GO:0007165	0.925	signal transduction
GO:0031330	0.907	negative regulation of cellular catabolic process
GO:0048518	0.853	positive regulation of biological process
GO:0051172	0.839	negative regulation of nitrogen compound metabolic process
GO:0010605	0.838	negative regulation of macromolecule metabolic process
GO:0080090	0.822	regulation of primary metabolic process
GO:0009893	0.813	positive regulation of metabolic process
GO:0018105	0.813	peptidyl-serine phosphorylation
GO:0048522	0.798	positive regulation of cellular process
GO:0042221	0.780	response to chemical
GO:0006950	0.779	response to stress
GO:0010468	0.778	regulation of gene expression
GO:0010604	0.774	positive regulation of macromolecule metabolic process
GO:0019219	0.769	regulation of nucleobase-containing compound metabolic process
GO:0048583	0.745	regulation of response to stimulus
GO:0051252	0.737	regulation of RNA metabolic process
GO:0065008	0.724	regulation of biological quality
GO:0010033	0.711	response to organic substance
GO:0035556	0.709	intracellular signal transduction
GO:0010628	0.707	positive regulation of gene expression
GO:0007166	0.671	cell surface receptor signaling pathway
GO:0051239	0.667	regulation of multicellular organismal process
GO:0033554	0.543	cellular response to stress
GO:0070887	0.530	cellular response to chemical stimulus
GO:0010608	0.506	post-transcriptional regulation of gene expression
GO:0080134	0.492	regulation of response to stress
GO:0009889	0.467	regulation of biosynthetic process
GO:0023051	0.455	regulation of signaling
GO:0010646	0.453	regulation of cell communication
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0009966	0.407	regulation of signal transduction
GO:0031326	0.402	regulation of cellular biosynthetic process
GO:0010556	0.400	regulation of macromolecule biosynthetic process
GO:0032501	0.371	multicellular organismal process
GO:0032502	0.366	developmental process
GO:0051173	0.365	positive regulation of nitrogen compound metabolic process
GO:0000165	0.364	MAPK cascade
GO:0048856	0.361	anatomical structure development
GO:1903311	0.331	regulation of mRNA metabolic process
GO:0051179	0.321	localization
GO:0043487	0.316	regulation of RNA stability
GO:0045934	0.313	negative regulation of nucleobase-containing compound metabolic process
GO:0043488	0.311	regulation of mRNA stability

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0005829	0.987	cytosol
GO:0031982	0.319	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]