StarFunc result for job id P49189

User Input

>input (494 residues)
MSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPATGRVIATFTCSGEKEVNLAVQNAKA
AFKIWSQKSGMERCRILLEAARIIREREDEIATMECINNGKSIFEARLDIDISWQCLEYY
AGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFK
PSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKI
MEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEI
LDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIY
VPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLA
AGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQL
KTVCVEMGDVESAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49189	1.000	1.000	0.000	494	1.000	1.000	P49189.pdb.gz	AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3
2	PDB:6vr6D	0.995	0.997	5.706E-99	493	0.998	1.000	6vr6D.pdb.gz	Inhibition, crystal structures, and in-solution oligomeric structure of aldehyde dehydrogenase 9A1.
3	PDB:6qakA	0.897	0.940	5.112E-84	471	0.951	0.998	6qakA.pdb.gz
4	AFDB:P17445	0.969	0.976	2.219E-68	490	0.506	0.510	P17445.pdb.gz	BETB_ECOLI Betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=betB PE=1 SV=3
5	AFDB:Q4WCK7	0.966	0.957	6.562E-63	499	0.472	0.467	Q4WCK7.pdb.gz	Q4WCK7_ASPFU Betaine aldehyde dehydrogenase (BadH), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04080 PE=3 SV=1
6	PDB:4fr8C	0.940	0.936	1.031E-61	496	0.403	0.401	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
7	AFDB:Q9STS1	0.956	0.939	1.135E-61	503	0.397	0.390	Q9STS1.pdb.gz	BADH2_ARATH Aminoaldehyde dehydrogenase ALDH10A9, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ALDH10A9 PE=1 SV=1
8	AFDB:A0A2I7G3B0	0.953	0.944	1.425E-61	499	0.387	0.383	A0A2I7G3B0.pdb.gz	ALDH1_TANCI Aldehyde dehydrogenase 1 OS=Tanacetum cinerariifolium OX=118510 GN=ALDH1 PE=1 SV=1
9	AFDB:A0A286XPF7	0.942	0.894	1.691E-61	521	0.405	0.384	A0A286XPF7.pdb.gz	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
10	AFDB:Q9SU63	0.950	0.873	1.790E-61	538	0.393	0.361	Q9SU63.pdb.gz	AL2B4_ARATH Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH2B4 PE=1 SV=1
11	AFDB:B3DKM0	0.948	0.905	2.380E-61	518	0.383	0.365	B3DKM0.pdb.gz
12	AFDB:O14293	0.949	0.932	2.668E-61	503	0.395	0.388	O14293.pdb.gz	YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.09c PE=1 SV=1
13	AFDB:G5DDC2	0.956	0.933	3.351E-61	506	0.383	0.374	G5DDC2.pdb.gz	ADH1B_MAIZE Aminoaldehyde dehydrogenase 1b OS=Zea mays OX=4577 GN=AMADH1B PE=1 SV=1
14	PDB:7mjcA	0.942	0.943	1.782E-60	493	0.387	0.387	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
15	PDB:6aljA	0.948	0.952	2.656E-60	492	0.381	0.382	6aljA.pdb.gz	Structural Basis of ALDH1A2 Inhibition by Irreversible and Reversible Small Molecule Inhibitors.
16	PDB:3iwjA	0.950	0.939	7.000E-60	500	0.379	0.374	3iwjA.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
17	PDB:5abmA	0.945	0.945	1.043E-59	494	0.381	0.381	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
18	PDB:3iwkH	0.947	0.942	1.646E-59	497	0.397	0.394	3iwkH.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
19	PDB:4v37A	0.951	0.949	5.146E-59	495	0.379	0.378	4v37A.pdb.gz	Identification of a Stable Thiohemiacetal Involving a Conserved Cysteine in the Substrate Inactivation of S. Oleracea Betaine Aldehyde Dehydrogenase
20	PDB:4i9bA	0.945	0.941	1.020E-58	496	0.395	0.393	4i9bA.pdb.gz	Plant ALDH10 family: identifying critical residues for substrate specificity and trapping a thiohemiacetal intermediate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49189	0.0	1022	494	1.000	1.000	AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3
2	Q9JLJ2	0.0	947	494	0.907	0.907	AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh9a1 PE=1 SV=1
3	Q9JLJ3	0.0	941	494	0.907	0.907	AL9A1_RAT 4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh9a1 PE=1 SV=1
4	P17445	3.96e-174	500	490	0.514	0.518	BETB_ECOLI Betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=betB PE=1 SV=3
5	Q4WCK7	5.66e-149	437	499	0.470	0.465	Q4WCK7_ASPFU Betaine aldehyde dehydrogenase (BadH), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04080 PE=3 SV=1
6	Q9VLC5	6.04e-127	381	520	0.397	0.377	Q9VLC5_DROME Aldehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Aldh PE=1 SV=1
7	Q9URW9	2.60e-126	379	496	0.391	0.389	YLX7_SCHPO Putative aldehyde dehydrogenase-like protein C922.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC922.07c PE=3 SV=1
8	P05091	6.70e-126	378	517	0.401	0.383	ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2
9	P11884	4.34e-125	376	519	0.397	0.378	ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh2 PE=1 SV=1
10	Q6TH48	1.94e-124	375	516	0.403	0.386	Q6TH48_DANRE Aldehyde dehydrogenase 2 family member, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ALDH2 PE=1 SV=1
11	A0A286XPF7	2.72e-124	374	521	0.397	0.376	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
12	P47738	3.54e-124	374	519	0.397	0.378	ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1
13	O14293	3.19e-123	371	503	0.391	0.384	YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.09c PE=1 SV=1
14	A0A384MTJ7	1.72e-121	367	517	0.385	0.368	A0A384MTJ7_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
15	P30837	1.72e-121	367	517	0.385	0.368	AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=4
16	O35945	2.08e-121	366	501	0.397	0.391	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
17	Q7SXU3	4.86e-120	363	516	0.397	0.380	Q7SXU3_DANRE Aldehyde dehydrogenase 2 OS=Danio rerio OX=7955 GN=aldh2a PE=1 SV=1
18	Q9CZS1	6.76e-120	363	519	0.385	0.366	AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus OX=10090 GN=Aldh1b1 PE=1 SV=1
19	Q9SU63	7.76e-119	361	538	0.391	0.359	AL2B4_ARATH Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH2B4 PE=1 SV=1
20	P17202	1.72e-118	358	497	0.381	0.378	BADH_SPIOL Aminoaldehyde dehydrogenase BADH OS=Spinacia oleracea OX=3562 GN=BADH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	1.8e-171	582.4	Aldehyde dehydrogenase family
2	PF07368 DUF1487	1.4e+02	13.3	Protein of unknown function (DUF1487)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265395	0.956	3-hydroxyisobutyrate dehydrogenase, mitochondrial
2	9606.ENSP00000361140	0.954	Alcohol dehydrogenase [NADP(+)]
3	9606.ENSP00000263182	0.950	Gamma-butyrobetaine dioxygenase
4	9606.ENSP00000379845	0.945	4-aminobutyrate aminotransferase, mitochondrial
5	9606.ENSP00000231420	0.944	Alanine--glyoxylate aminotransferase 2, mitochondrial
6	9606.ENSP00000231887	0.943	Peroxisomal bifunctional enzyme
7	9606.ENSP00000450436	0.943	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
8	9606.ENSP00000479130	0.935	Acyl-CoA synthetase family member 3, mitochondrial
9	9606.ENSP00000325548	0.933	Cytosolic non-specific dipeptidase
10	9606.ENSP00000324343	0.928	Beta-ureidopropionase
11	9606.ENSP00000411613	0.926	Amiloride-sensitive amine oxidase [copper-containing]
12	9606.ENSP00000389009	0.922	Carnosine synthase 1
13	9606.ENSP00000370639	0.917	Acetylserotonin O-methyltransferase
14	9606.ENSP00000379895	0.909	Glycine amidinotransferase, mitochondrial
15	9606.ENSP00000282538	0.908	Acidic amino acid decarboxylase GADL1
16	9606.ENSP00000389175	0.906	Glycerate kinase
17	9606.ENSP00000303246	0.904	Acyl-coenzyme A thioesterase 12
18	9606.ENSP00000351682	0.904	Carnosine dipeptidase 1
19	9606.ENSP00000296412	0.882	Alcohol dehydrogenase class-3
20	9606.ENSP00000242592	0.871	Short-chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004030	1.000	aldehyde dehydrogenase [NAD(P)+] activity
GO:0004029	0.994	aldehyde dehydrogenase (NAD+) activity
GO:0005488	0.989	binding
GO:0005515	0.913	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.768	nitrogen compound metabolic process
GO:1901564	0.589	organonitrogen compound metabolic process
GO:0044238	0.503	primary metabolic process
GO:0044281	0.447	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.965	organelle
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0005576	0.860	extracellular region
GO:0031982	0.838	vesicle
GO:1903561	0.803	extracellular vesicle
GO:0070062	0.793	extracellular exosome
GO:0005739	0.720	mitochondrion
GO:0070013	0.688	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.5	1.000	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.994	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.994	aldehyde dehydrogenase (NAD(+)).

[back to server]