StarFunc result for job id P49238

User Input

>input (355 residues)
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK
KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI
TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP
EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF
FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF
RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49238	1.000	1.000	1.776E-45	355	1.000	1.000	P49238.pdb.gz	CX3C1_HUMAN CX3C chemokine receptor 1 OS=Homo sapiens OX=9606 GN=CX3CR1 PE=1 SV=1
2	AFDB:P35411	0.875	0.877	8.635E-37	354	0.820	0.822	P35411.pdb.gz	CX3C1_RAT CX3C chemokine receptor 1 OS=Rattus norvegicus OX=10116 GN=Cx3cr1 PE=1 SV=1
3	AFDB:O55193	0.796	0.759	5.300E-22	373	0.425	0.405	O55193.pdb.gz	CCR2_RAT C-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ccr2 PE=2 SV=1
4	AFDB:P51685	0.793	0.793	7.792E-22	355	0.377	0.377	P51685.pdb.gz	CCR8_HUMAN C-C chemokine receptor type 8 OS=Homo sapiens OX=9606 GN=CCR8 PE=1 SV=1
5	AFDB:G3V7C3	0.804	0.794	1.481E-21	360	0.420	0.414	G3V7C3.pdb.gz	G3V7C3_RAT C-C motif chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=3 SV=1
6	AFDB:O08556	0.823	0.825	1.614E-21	354	0.403	0.404	O08556.pdb.gz	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
7	AFDB:P32246	0.801	0.801	2.373E-21	355	0.400	0.400	P32246.pdb.gz	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
8	AFDB:P56484	0.797	0.802	3.642E-21	353	0.406	0.408	P56484.pdb.gz	CCR8_MOUSE C-C chemokine receptor type 8 OS=Mus musculus OX=10090 GN=Ccr8 PE=2 SV=1
9	AFDB:F1QYD4	0.799	0.792	8.577E-21	358	0.386	0.383	F1QYD4.pdb.gz	F1QYD4_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.3 PE=3 SV=3
10	AFDB:A1LPE5	0.812	0.812	9.344E-21	355	0.389	0.389	A1LPE5.pdb.gz
11	PDB:7vl9R	0.764	0.890	8.801E-19	302	0.372	0.437	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
12	PDB:7f1qR	0.740	0.717	2.680E-18	367	0.349	0.338	7f1qR.pdb.gz
13	PDB:7x9yR	0.708	0.848	2.736E-16	293	0.358	0.433	7x9yR.pdb.gz
14	PDB:7f1tA	0.750	0.635	2.981E-16	423	0.344	0.288	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
15	PDB:7rkfR	0.752	0.893	4.574E-16	296	0.327	0.392	7rkfR.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
16	PDB:7f1rR	0.684	0.740	1.454E-15	327	0.346	0.376	7f1rR.pdb.gz
17	PDB:6wwzR	0.764	0.869	2.764E-15	310	0.313	0.358	6wwzR.pdb.gz
18	PDB:5t1aA	0.706	0.569	1.136E-14	445	0.366	0.292	5t1aA.pdb.gz	Structure of CC chemokine receptor 2 with orthosteric and allosteric antagonists.
19	PDB:7f6hA	0.730	0.841	5.542E-14	305	0.239	0.279	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
20	PDB:6lfmR	0.731	0.838	2.945E-13	307	0.304	0.352	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35411	0.0	534	354	0.820	0.822	CX3C1_RAT CX3C chemokine receptor 1 OS=Rattus norvegicus OX=10116 GN=Cx3cr1 PE=1 SV=1
2	P49238	0.0	728	355	1.000	1.000	CX3C1_HUMAN CX3C chemokine receptor 1 OS=Homo sapiens OX=9606 GN=CX3CR1 PE=1 SV=1
3	Q9Z0D9	0.0	557	354	0.825	0.828	CX3C1_MOUSE CX3C chemokine receptor 1 OS=Mus musculus OX=10090 GN=Cx3cr1 PE=1 SV=1
4	P51683	5.85e-92	281	373	0.417	0.397	CCR2_MOUSE C-C chemokine receptor type 2 OS=Mus musculus OX=10090 GN=Ccr2 PE=1 SV=2
5	O55193	3.55e-90	277	373	0.411	0.391	CCR2_RAT C-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ccr2 PE=2 SV=1
6	A0N0Q1	1.18e-89	275	360	0.420	0.414	A0N0Q1_HUMAN Chemokine (C-C motif) receptor 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=2 SV=1
7	P51679	1.18e-89	275	360	0.420	0.414	CCR4_HUMAN C-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=1 SV=1
8	P51680	1.55e-89	275	360	0.425	0.419	CCR4_MOUSE C-C chemokine receptor type 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=2 SV=2
9	G3V7C3	5.26e-87	268	360	0.408	0.403	G3V7C3_RAT C-C motif chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=3 SV=1
10	Q91ZH4	5.50e-87	268	360	0.408	0.403	Q91ZH4_RAT C-C chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=2 SV=2
11	P32246	1.46e-85	264	355	0.389	0.389	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
12	P41597	1.63e-85	265	374	0.406	0.385	CCR2_HUMAN C-C chemokine receptor type 2 OS=Homo sapiens OX=9606 GN=CCR2 PE=1 SV=1
13	P51678	1.13e-84	262	359	0.403	0.398	CCR3_MOUSE Probable C-C chemokine receptor type 3 OS=Mus musculus OX=10090 GN=Ccr3 PE=2 SV=2
14	P51682	6.82e-84	260	354	0.380	0.381	CCR5_MOUSE C-C chemokine receptor type 5 OS=Mus musculus OX=10090 GN=Ccr5 PE=2 SV=3
15	P56484	8.12e-84	260	353	0.389	0.391	CCR8_MOUSE C-C chemokine receptor type 8 OS=Mus musculus OX=10090 GN=Ccr8 PE=2 SV=1
16	O54814	5.93e-83	258	359	0.377	0.373	CCR3_RAT C-C chemokine receptor type 3 OS=Rattus norvegicus OX=10116 GN=Ccr3 PE=2 SV=1
17	A0A140LFQ7	1.02e-79	249	354	0.361	0.362	A0A140LFQ7_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.2 PE=3 SV=1
18	F1QYD4	1.95e-78	246	358	0.355	0.352	F1QYD4_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.3 PE=3 SV=3
19	O08556	1.48e-77	244	354	0.369	0.370	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
20	P51685	2.82e-77	243	355	0.386	0.386	CCR8_HUMAN C-C chemokine receptor type 8 OS=Homo sapiens OX=9606 GN=CCR8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.9e-51	184.9	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	0.022	25.7	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351059

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000006053	0.999	Fractalkine
2	9606.ENSP00000225831	0.941	C-C motif chemokine 2
3	9606.ENSP00000379110	0.926	Growth-regulated alpha protein
4	9606.ENSP00000477908	0.918	C-C motif chemokine 3
5	9606.ENSP00000219235	0.873	C-C motif chemokine 22
6	9606.ENSP00000474412	0.862	C-C motif chemokine 5
7	9606.ENSP00000259607	0.849	C-C motif chemokine 21
8	9606.ENSP00000379140	0.848	Stromal cell-derived factor 1
9	9606.ENSP00000441691	0.847	Integrin alpha-M
10	9606.ENSP00000378365	0.840	C-C motif chemokine 26
11	9606.ENSP00000305651	0.835	C-X-C motif chemokine 10
12	9606.ENSP00000482259	0.829	C-C motif chemokine 4
13	9606.ENSP00000293778	0.827	C-X-C motif chemokine 16
14	9606.ENSP00000306512	0.815	Interleukin-8
15	9606.ENSP00000354901	0.800	C-X-C motif chemokine 9
16	9606.ENSP00000286301	0.799	Macrophage colony-stimulating factor 1 receptor
17	9606.ENSP00000367832	0.799	C-C motif chemokine 7
18	9606.ENSP00000286758	0.795	C-X-C motif chemokine 13
19	9606.ENSP00000400533	0.794	C-C motif chemokine 24
20	9606.ENSP00000427279	0.794	C-X-C motif chemokine 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0001637	1.000	G protein-coupled chemoattractant receptor activity
GO:0005488	0.999	binding
GO:0005515	0.994	protein binding
GO:0004950	0.987	chemokine receptor activity
GO:0005102	0.453	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.991	cellular process
GO:0040011	0.990	locomotion
GO:0050794	0.990	regulation of cellular process
GO:0051716	0.977	cellular response to stimulus
GO:0042221	0.971	response to chemical
GO:0007165	0.952	signal transduction
GO:0006935	0.943	chemotaxis
GO:0048518	0.875	positive regulation of biological process
GO:0002376	0.803	immune system process
GO:0048522	0.762	positive regulation of cellular process
GO:0051239	0.611	regulation of multicellular organismal process
GO:0032501	0.606	multicellular organismal process
GO:0048583	0.599	regulation of response to stimulus
GO:0006952	0.537	defense response
GO:0040012	0.496	regulation of locomotion
GO:0070887	0.487	cellular response to chemical stimulus
GO:0019222	0.478	regulation of metabolic process
GO:0002682	0.469	regulation of immune system process
GO:0048519	0.457	negative regulation of biological process
GO:0044419	0.447	biological process involved in interspecies interaction between organisms
GO:0006955	0.446	immune response
GO:0060255	0.434	regulation of macromolecule metabolic process
GO:0002684	0.434	positive regulation of immune system process
GO:0048584	0.432	positive regulation of response to stimulus
GO:0048523	0.430	negative regulation of cellular process
GO:0009607	0.420	response to biotic stimulus
GO:0010468	0.404	regulation of gene expression
GO:0009893	0.375	positive regulation of metabolic process
GO:0023051	0.371	regulation of signaling
GO:0010646	0.370	regulation of cell communication
GO:0032502	0.358	developmental process
GO:0048856	0.354	anatomical structure development
GO:0051707	0.352	response to other organism
GO:0010604	0.352	positive regulation of macromolecule metabolic process
GO:2000145	0.339	regulation of cell motility
GO:0051240	0.327	positive regulation of multicellular organismal process
GO:0030334	0.326	regulation of cell migration
GO:0010033	0.323	response to organic substance
GO:0032101	0.321	regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.976	cell surface
GO:0043227	0.756	membrane-bounded organelle
GO:0005622	0.655	intracellular anatomical structure
GO:0005737	0.415	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]