StarFunc result for job id P49279

User Input

>input (550 residues)
MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIPIPDTKPGTFSLRKLWA
FTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKD
LGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRIPLWGGVLITIVD
TFFFLFLDNYGLRKLEAFFGLLITIMALTFGYEYVVARPEQGALLRGLFLPSCPGCGHPE
LLQAVGIVGAIIMPHNIYLHSALVKSREIDRARRADIREANMYFLIEATIALSVSFIINL
FVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGVILGCLFGPAA
LYIWAIGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTRSCAILPTVLVAVFRD
LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPTLMQEFANGLLNKVVTSSIMVLVCAIN
LYFVVSYLPSLPHPAYFGLAALLAAAYLGLSTYLVWTCCLAHGATFLAHSSHHHFLYGLL
EEDQKGETSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49279	1.000	1.000	2.302E-75	550	1.000	1.000	P49279.pdb.gz	NRAM1_HUMAN Natural resistance-associated macrophage protein 1 OS=Homo sapiens OX=9606 GN=SLC11A1 PE=2 SV=1
2	AFDB:P41251	0.926	0.929	1.173E-64	548	0.867	0.870	P41251.pdb.gz	NRAM1_MOUSE Natural resistance-associated macrophage protein 1 OS=Mus musculus OX=10090 GN=Slc11a1 PE=1 SV=2
3	AFDB:O77741	0.924	0.945	2.343E-63	538	0.851	0.870	O77741.pdb.gz	NRAM1_PIG Natural resistance-associated macrophage protein 1 OS=Sus scrofa OX=9823 GN=SLC11A1 PE=2 SV=1
4	AFDB:P51027	0.910	0.902	3.260E-55	555	0.685	0.679	P51027.pdb.gz	NRAM1_CHICK Natural resistance-associated macrophage protein 1 OS=Gallus gallus OX=9031 GN=SLC11A1 PE=2 SV=1
5	AFDB:B3DGS9	0.892	0.897	7.390E-52	547	0.644	0.647	B3DGS9.pdb.gz
6	AFDB:O54902	0.889	0.861	1.092E-51	568	0.629	0.609	O54902.pdb.gz	NRAM2_RAT Natural resistance-associated macrophage protein 2 OS=Rattus norvegicus OX=10116 GN=Slc11a2 PE=1 SV=1
7	AFDB:B3F8C5	0.886	0.864	1.757E-50	564	0.627	0.612	B3F8C5.pdb.gz	B3F8C5_CHICK NRAMP2 isoform 1 OS=Gallus gallus OX=9031 GN=SLC11A2 PE=2 SV=1
8	AFDB:A0A2R8YD71	0.909	0.874	3.226E-50	573	0.627	0.602	A0A2R8YD71.pdb.gz	A0A2R8YD71_HUMAN Solute carrier family 11 member 2 OS=Homo sapiens OX=9606 GN=SLC11A2 PE=1 SV=1
9	AFDB:P49283	0.888	0.821	2.255E-45	596	0.542	0.500	P49283.pdb.gz	MVL_DROME Protein Malvolio OS=Drosophila melanogaster OX=7227 GN=Mvl PE=2 SV=2
10	AFDB:Q21434	0.851	0.833	1.074E-43	562	0.471	0.461	Q21434.pdb.gz	NRAMA_CAEEL NRAMP-like transporter smf-1 OS=Caenorhabditis elegans OX=6239 GN=smf-1 PE=1 SV=2
11	PDB:5j4nA	0.455	0.548	2.982E-6	437	0.111	0.140	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
12	PDB:7s1xB	0.510	0.347	4.807E-6	871	0.107	0.068	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
13	PDB:6vrhA	0.505	0.512	3.108E-5	541	0.111	0.113	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
14	PDB:7dskB	0.499	0.576	3.245E-5	464	0.124	0.147	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
15	PDB:7p9uB	0.479	0.557	1.764E-4	455	0.122	0.147	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
16	PDB:7cmhB	0.466	0.539	2.098E-4	458	0.115	0.138	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
17	PDB:7vsiA	0.445	0.423	3.101E-4	586	0.142	0.133	7vsiA.pdb.gz	Structural basis of inhibition of the human SGLT2-MAP17 glucose transporter.
18	PDB:2witA	0.493	0.507	3.532E-4	531	0.122	0.126	2witA.pdb.gz
19	PDB:7d10A	0.495	0.588	4.583E-4	446	0.113	0.139	7d10A.pdb.gz
20	PDB:7ccsB	0.477	0.552	5.947E-4	454	0.116	0.141	7ccsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0X8GKR4	0.0	652	568	0.625	0.606	A0A0X8GKR4_HUMAN Natural resistance-associated macrophage protein 2 isoform 2 OS=Homo sapiens OX=9606 GN=SLC11A2 PE=2 SV=1
2	A0A2R8YD71	0.0	644	573	0.629	0.604	A0A2R8YD71_HUMAN Solute carrier family 11 member 2 OS=Homo sapiens OX=9606 GN=SLC11A2 PE=1 SV=1
3	B3F8C5	0.0	684	564	0.635	0.619	B3F8C5_CHICK NRAMP2 isoform 1 OS=Gallus gallus OX=9031 GN=SLC11A2 PE=2 SV=1
4	F8W1P7	0.0	599	482	0.575	0.656	F8W1P7_HUMAN Solute carrier family 11 member 2 OS=Homo sapiens OX=9606 GN=SLC11A2 PE=1 SV=1
5	O54902	0.0	681	568	0.633	0.613	NRAM2_RAT Natural resistance-associated macrophage protein 2 OS=Rattus norvegicus OX=10116 GN=Slc11a2 PE=1 SV=1
6	O77741	0.0	912	538	0.849	0.868	NRAM1_PIG Natural resistance-associated macrophage protein 1 OS=Sus scrofa OX=9823 GN=SLC11A1 PE=2 SV=1
7	P41251	0.0	950	548	0.867	0.870	NRAM1_MOUSE Natural resistance-associated macrophage protein 1 OS=Mus musculus OX=10090 GN=Slc11a1 PE=1 SV=2
8	P49279	0.0	1117	550	1.000	1.000	NRAM1_HUMAN Natural resistance-associated macrophage protein 1 OS=Homo sapiens OX=9606 GN=SLC11A1 PE=2 SV=1
9	P49281	0.0	652	568	0.625	0.606	NRAM2_HUMAN Natural resistance-associated macrophage protein 2 OS=Homo sapiens OX=9606 GN=SLC11A2 PE=1 SV=2
10	P49282	0.0	680	568	0.627	0.607	NRAM2_MOUSE Natural resistance-associated macrophage protein 2 OS=Mus musculus OX=10090 GN=Slc11a2 PE=1 SV=2
11	P49283	0.0	590	596	0.533	0.492	MVL_DROME Protein Malvolio OS=Drosophila melanogaster OX=7227 GN=Mvl PE=2 SV=2
12	P51027	0.0	756	555	0.665	0.659	NRAM1_CHICK Natural resistance-associated macrophage protein 1 OS=Gallus gallus OX=9031 GN=SLC11A1 PE=2 SV=1
13	Q0GMA8	0.0	676	543	0.636	0.645	Q0GMA8_CHICK SLC11A2 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
14	Q1RLY4	0.0	686	547	0.636	0.640	Q1RLY4_DANRE Natural resistance-associated macrophage protein 2 OS=Danio rerio OX=7955 GN=fa07b10 PE=2 SV=1
15	Q95XG8	0.0	532	560	0.520	0.511	NRAMC_CAEEL NRAMP-like transporter smf-3 OS=Caenorhabditis elegans OX=6239 GN=smf-3 PE=1 SV=3
16	Q21433	2.62e-177	513	546	0.469	0.473	NRAMB_CAEEL NRAMP-like transporter smf-2 OS=Caenorhabditis elegans OX=6239 GN=smf-2 PE=1 SV=2
17	Q21434	1.83e-174	506	562	0.469	0.459	NRAMA_CAEEL NRAMP-like transporter smf-1 OS=Caenorhabditis elegans OX=6239 GN=smf-1 PE=1 SV=2
18	Q869V1	2.02e-150	444	533	0.411	0.424	NRAM1_DICDI Metal transporter nramp1 homolog OS=Dictyostelium discoideum OX=44689 GN=nramp1 PE=2 SV=1
19	Q9SNV9	5.40e-145	429	509	0.436	0.472	NRAM3_ARATH Metal transporter Nramp3 OS=Arabidopsis thaliana OX=3702 GN=NRAMP3 PE=1 SV=2
20	Q9FN18	3.54e-143	424	512	0.418	0.449	NRAM4_ARATH Metal transporter Nramp4 OS=Arabidopsis thaliana OX=3702 GN=NRAMP4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01566 Nramp	2.8e-114	393.5	Natural resistance-associated macrophage protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378364	0.808	Natural resistance-associated macrophage protein 2
2	9606.ENSP00000261024	0.737	Solute carrier family 40 member 1
3	9606.ENSP00000306361	0.635	Fibrinogen alpha chain
4	9606.ENSP00000321424	0.635	Sodium-dependent phosphate transport protein 2A
5	9606.ENSP00000467141	0.634	Titin
6	9606.ENSP00000471894	0.626	Hepcidin
7	9606.ENSP00000259392	0.616	Probable low affinity copper uptake protein 2
8	9606.ENSP00000429200	0.602	Mitoferrin-1
9	9606.ENSP00000345728	0.593	Copper-transporting ATPase 1
10	9606.ENSP00000227163	0.581	Transcription factor PU.1
11	9606.ENSP00000248444	0.581	Villin-1
12	9606.ENSP00000260010	0.574	Toll-like receptor 2
13	9606.ENSP00000471493	0.573	fMet-Leu-Phe receptor
14	9606.ENSP00000292432	0.569	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
15	9606.ENSP00000447173	0.566	Vitamin D3 receptor
16	9606.ENSP00000430620	0.564	Hephaestin
17	9606.ENSP00000415434	0.562	Ubiquitin carboxyl-terminal hydrolase 40
18	9606.ENSP00000363089	0.561	Toll-like receptor 4
19	9606.ENSP00000224073	0.559	Endothelial differentiation-related factor 1
20	9606.ENSP00000372326	0.556	Ferrochelatase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046915	1.000	transition metal ion transmembrane transporter activity
GO:0005488	0.975	binding
GO:0005384	0.942	manganese ion transmembrane transporter activity
GO:0022804	0.934	active transmembrane transporter activity
GO:0005515	0.836	protein binding
GO:0005381	0.762	iron ion transmembrane transporter activity
GO:0015291	0.725	secondary active transmembrane transporter activity
GO:0015078	0.634	proton transmembrane transporter activity
GO:0015297	0.616	antiporter activity
GO:0022853	0.609	active monoatomic ion transmembrane transporter activity
GO:0140828	0.561	metal cation:monoatomic cation antiporter activity
GO:0051139	0.552	metal cation:proton antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0055080	0.939	monoatomic cation homeostasis
GO:0006811	0.923	monoatomic ion transport
GO:0000041	0.903	transition metal ion transport
GO:0065007	0.846	biological regulation
GO:0055085	0.841	transmembrane transport
GO:0019725	0.807	cellular homeostasis
GO:0050794	0.759	regulation of cellular process
GO:0098771	0.701	inorganic ion homeostasis
GO:0042221	0.656	response to chemical
GO:0051716	0.556	cellular response to stimulus
GO:0030003	0.456	intracellular monoatomic cation homeostasis
GO:0006950	0.455	response to stress
GO:0055072	0.429	iron ion homeostasis
GO:0008152	0.356	metabolic process
GO:0009605	0.338	response to external stimulus
GO:0048518	0.333	positive regulation of biological process
GO:0002376	0.326	immune system process
GO:0006952	0.318	defense response
GO:0034220	0.307	monoatomic ion transmembrane transport
GO:0051707	0.303	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0071944	0.996	cell periphery
GO:0012505	0.996	endomembrane system
GO:0031982	0.980	vesicle
GO:0031090	0.976	organelle membrane
GO:0031410	0.967	cytoplasmic vesicle
GO:0005634	0.962	nucleus
GO:0005886	0.956	plasma membrane
GO:0005768	0.949	endosome
GO:0030659	0.933	cytoplasmic vesicle membrane
GO:0098588	0.916	bounding membrane of organelle
GO:0030141	0.825	secretory granule
GO:0030139	0.682	endocytic vesicle
GO:0005770	0.675	late endosome
GO:0010008	0.570	endosome membrane
GO:0043233	0.556	organelle lumen
GO:0070013	0.537	intracellular organelle lumen
GO:0005774	0.493	vacuolar membrane
GO:0000323	0.446	lytic vacuole
GO:0098852	0.390	lytic vacuole membrane
GO:0030666	0.372	endocytic vesicle membrane
GO:0045335	0.350	phagocytic vesicle
GO:0030670	0.340	phagocytic vesicle membrane
GO:0005615	0.334	extracellular space
GO:0005764	0.332	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28699	0.942	Mn(2+)(in) = Mn(2+)(out)

[back to server]