StarFunc result for job id P49326

User Input

>input (533 residues)
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
THFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPN
LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY
VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGK
WDGARKAILTTDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QYY6	1.000	1.000	0.000	533	1.000	1.000	A0A024QYY6.pdb.gz
2	AFDB:P97872	0.991	0.991	6.525E-101	533	0.841	0.841	P97872.pdb.gz	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
3	AFDB:Q99518	0.943	0.939	2.920E-79	535	0.559	0.557	Q99518.pdb.gz	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
4	AFDB:Q8K2I3	0.941	0.938	4.802E-79	535	0.563	0.561	Q8K2I3.pdb.gz	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
5	AFDB:P31513	0.941	0.942	2.178E-74	532	0.538	0.539	P31513.pdb.gz	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
6	AFDB:Q9EQ76	0.947	0.950	4.989E-74	531	0.503	0.505	Q9EQ76.pdb.gz	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
7	AFDB:P36365	0.930	0.932	7.485E-73	532	0.505	0.506	P36365.pdb.gz	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
8	AFDB:Q95LA2	0.926	0.928	7.910E-73	532	0.520	0.521	Q95LA2.pdb.gz	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
9	AFDB:Q01740	0.930	0.932	2.261E-72	532	0.514	0.515	Q01740.pdb.gz	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	AFDB:P16549	0.931	0.933	5.180E-72	532	0.508	0.509	P16549.pdb.gz	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
11	PDB:2xlrC	0.613	0.717	1.242E-27	452	0.212	0.250	2xlrC.pdb.gz	Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
12	PDB:2gv8A	0.603	0.720	8.923E-25	442	0.197	0.238	2gv8A.pdb.gz	Mechanism of action of a flavin-containing monooxygenase.
13	PDB:3uozA	0.556	0.549	1.200E-20	540	0.171	0.169	3uozA.pdb.gz	Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
14	PDB:3s5wB	0.473	0.588	3.500E-13	414	0.113	0.145	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
15	PDB:5xhuA	0.305	0.462	1.738E-12	329	0.128	0.207	5xhuA.pdb.gz	Crystal structure of ycgT from bacillus subtilis
16	PDB:1f6mA	0.428	0.666	4.448E-12	320	0.128	0.212	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
17	PDB:3itjB	0.335	0.515	1.019E-11	319	0.098	0.163	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
18	PDB:4o5qA	0.344	0.351	1.138E-11	521	0.101	0.104	4o5qA.pdb.gz	Structure, mechanism and ensemble formation of the alkylhydroperoxide reductase subunits AhpC and AhpF from Escherichia coli
19	PDB:4b65A	0.482	0.550	2.756E-11	456	0.111	0.129	4b65A.pdb.gz	Structural Insight Into the Mechanism of Oxygen Activation and Substrate Selectivity of Flavin-Dependent N-Hydroxylating Monooxygenases.
20	PDB:2hqmA	0.387	0.439	1.295E-10	461	0.124	0.143	2hqmA.pdb.gz	Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16549	0.0	580	532	0.508	0.509	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
2	P31512	0.0	581	558	0.516	0.493	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3
3	P31513	0.0	575	532	0.527	0.528	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
4	P36365	0.0	583	532	0.505	0.506	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
5	P36367	0.0	556	555	0.497	0.477	FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus OX=9986 GN=FMO4 PE=2 SV=2
6	P49326	0.0	1111	533	1.000	1.000	FMO5_HUMAN Flavin-containing monooxygenase 5 OS=Homo sapiens OX=9606 GN=FMO5 PE=1 SV=2
7	P50285	0.0	576	532	0.499	0.500	FMO1_MOUSE Flavin-containing monooxygenase 1 OS=Mus musculus OX=10090 GN=Fmo1 PE=1 SV=1
8	P97872	0.0	966	533	0.841	0.841	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
9	Q01740	0.0	578	532	0.512	0.513	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	Q8K2I3	0.0	672	535	0.568	0.566	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
11	Q8K4C0	0.0	966	533	0.842	0.842	FMO5_RAT Flavin-containing monooxygenase 5 OS=Rattus norvegicus OX=10116 GN=Fmo5 PE=1 SV=3
12	Q8VHG0	0.0	551	560	0.499	0.475	FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3
13	Q95LA2	0.0	581	532	0.505	0.506	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
14	Q99518	0.0	662	535	0.561	0.559	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
15	Q9EQ76	0.0	585	531	0.501	0.503	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
16	G5EBJ9	1.34e-156	459	529	0.424	0.427	G5EBJ9_CAEEL Flavin-containing monooxygenase OS=Caenorhabditis elegans OX=6239 GN=fmo-2 PE=1 SV=1
17	Q9W1E9	9.16e-42	157	416	0.236	0.303	Q9W1E9_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-1 PE=2 SV=1
18	Q9LMA1	4.86e-41	157	530	0.261	0.262	FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=FMO1 PE=2 SV=1
19	Q94BV5	7.50e-35	138	452	0.231	0.272	GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana OX=3702 GN=At1g62600 PE=2 SV=1
20	Q7K3U4	3.63e-34	135	429	0.152	0.189	Q7K3U4_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	0.0037	28.5	FAD dependent oxidoreductase
2	PF00743 FMO-like	1.2e-279	939.9	Flavin-binding monooxygenase-like
3	PF13434 Lys_Orn_oxgnase	0.0001	33.2	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
4	PF13450 NAD_binding_8	0.17	23.5	NAD(P)-binding Rossmann-like domain
5	PF13454 NAD_binding_9	92	14.5	FAD-NAD(P)-binding
6	PF00070 Pyr_redox	8.2	18.3	Pyridine nucleotide-disulphide oxidoreductase
7	PF07992 Pyr_redox_2	3.6e-05	34.7	Pyridine nucleotide-disulphide oxidoreductase
8	PF13738 Pyr_redox_3	8.4e-14	63.1	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337915	0.936	Cytochrome P450 3A4
2	9606.ENSP00000353820	0.936	Cytochrome P450 2D6
3	9606.ENSP00000260682	0.928	Cytochrome P450 2C9
4	9606.ENSP00000319673	0.767	G protein-coupled receptor 89A
5	9606.ENSP00000358233	0.767	annotation not available
6	9606.ENSP00000267163	0.721	Retinoblastoma-associated protein
7	9606.ENSP00000463574	0.716	Lysophosphatidic acid phosphatase type 6
8	9606.ENSP00000477509	0.681	Neuroblastoma breakpoint family member 11
9	9606.ENSP00000265395	0.661	3-hydroxyisobutyrate dehydrogenase, mitochondrial
10	9606.ENSP00000357669	0.644	Atrial natriuretic peptide receptor 1
11	9606.ENSP00000358262	0.641	Chromodomain-helicase-DNA-binding protein 1-like
12	9606.ENSP00000254101	0.614	5'-AMP-activated protein kinase subunit beta-2
13	9606.ENSP00000209929	0.595	Dimethylaniline monooxygenase [N-oxide-forming] 2
14	9606.ENSP00000325120	0.577	Progesterone receptor
15	9606.ENSP00000234739	0.561	B-cell CLL/lymphoma 9 protein
16	9606.ENSP00000356729	0.561	Dimethylaniline monooxygenase [N-oxide-forming] 3
17	9606.ENSP00000355995	0.560	Corticosteroid 11-beta-dehydrogenase isozyme 1
18	9606.ENSP00000452521	0.546	N-alpha-acetyltransferase 30
19	9606.ENSP00000358238	0.538	Gap junction alpha-8 protein
20	9606.ENSP00000484552	0.528	Gap junction alpha-5 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016709	0.999	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005488	0.945	binding
GO:0005515	0.852	protein binding
GO:0004499	0.782	N,N-dimethylaniline monooxygenase activity
GO:0097159	0.567	organic cyclic compound binding
GO:1901363	0.561	heterocyclic compound binding
GO:0036094	0.551	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0044238	0.978	primary metabolic process
GO:0044281	0.976	small molecule metabolic process
GO:1901564	0.972	organonitrogen compound metabolic process
GO:1901360	0.814	organic cyclic compound metabolic process
GO:0072524	0.770	pyridine-containing compound metabolic process
GO:0006725	0.719	cellular aromatic compound metabolic process
GO:0050896	0.663	response to stimulus
GO:0042221	0.510	response to chemical
GO:0046496	0.473	nicotinamide nucleotide metabolic process
GO:0051716	0.466	cellular response to stimulus
GO:0006805	0.419	xenobiotic metabolic process
GO:0065007	0.373	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0005829	0.946	cytosol
GO:0016020	0.677	membrane
GO:0031090	0.476	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.13.-	0.999	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:24468	0.782	H(+) + N,N-dimethylaniline + NADPH + O2 = H2O + N,N-dimethylaniline N-oxide + NADP(+)
EC:1.14.13.8	0.782	flavin-containing monooxygenase.

[back to server]