StarFunc result for job id P49327

User Input

>input (2511 residues)
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL
PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGP
EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS
TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFE
FVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCT
IIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA
RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQ
WDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRL
LWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVV
SRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQL
CKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ
VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL
SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVA
ALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESL
FSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP
VWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSSLRHAQPTCPG
AQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAK
GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKG
VDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF
NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEE
PEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGI
RTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLL
ENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSA
MERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN
QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSV
EVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLD
SIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGS
PTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA
VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGA
DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2vz8A	0.764	0.974	0.000	1962	0.614	0.786	2vz8A.pdb.gz
2	PDB:2vz8B	0.725	0.896	0.000	2004	0.628	0.787	2vz8B.pdb.gz
3	PDB:2vz9B	0.752	0.895	0.000	2086	0.650	0.782	2vz9B.pdb.gz	The Crystal Structure of a Mammalian Fatty Acid Synthase.
4	AFDB:A0A089QRB9	0.289	0.340	0.000	2085	0.211	0.254	A0A089QRB9.pdb.gz	MSL3_MYCTU Mycolipanoate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=msl3 PE=1 SV=2
5	AFDB:A0A098D8A0	0.317	0.338	0.000	2352	0.229	0.244	A0A098D8A0.pdb.gz	ZEA2_GIBZE Highly reducing polyketide synthase ZEA2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEA2 PE=2 SV=1
6	AFDB:A0A1R3RGK0	0.313	0.310	0.000	2541	0.206	0.204	A0A1R3RGK0.pdb.gz	OTAA_ASPC5 Highly reducing polyketide synthase otaA OS=Aspergillus carbonarius (strain ITEM 5010) OX=602072 GN=otaA PE=1 SV=1
7	AFDB:A2R6H1	0.308	0.303	0.000	2550	0.205	0.202	A2R6H1.pdb.gz	OTAA_ASPNC Highly reducing polyketide synthase otaA OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=otaA PE=2 SV=2
8	AFDB:B2HIL7	0.315	0.370	0.000	2104	0.216	0.258	B2HIL7.pdb.gz	MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) OX=216594 GN=pks15/1 PE=1 SV=1
9	AFDB:B7Z001	0.768	0.759	0.000	2540	0.431	0.426	B7Z001.pdb.gz	B7Z001_DROME Fatty acid synthase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=FASN1 PE=1 SV=2
10	AFDB:M9PB21	0.762	0.793	0.000	2410	0.419	0.436	M9PB21.pdb.gz	M9PB21_DROME Fatty acid synthase 2, isoform B OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=1 SV=1
11	AFDB:O53901	0.291	0.340	0.000	2108	0.213	0.254	O53901.pdb.gz	PKS5_MYCTU Mycocerosic acid synthase-like polyketide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks5 PE=1 SV=2
12	AFDB:P12276	0.909	0.908	0.000	2512	0.661	0.660	P12276.pdb.gz	FAS_CHICK Fatty acid synthase OS=Gallus gallus OX=9031 GN=FASN PE=1 SV=5
13	AFDB:P12785	0.932	0.935	0.000	2505	0.820	0.822	P12785.pdb.gz	FAS_RAT Fatty acid synthase OS=Rattus norvegicus OX=10116 GN=Fasn PE=1 SV=3
14	PDB:7cpxA	0.333	0.362	8.757E-97	2262	0.194	0.215	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
15	PDB:2wgeA	0.147	0.835	8.310E-23	415	0.038	0.229	2wgeA.pdb.gz	Crystal Structures of Mycobacterium Tuberculosis Kasa Show Mode of Action within Cell Wall Biosynthesis and its Inhibition by Thiolactomycin
16	PDB:5kofA	0.148	0.869	1.948E-22	407	0.039	0.238	5kofA.pdb.gz	Molecular basis for interactions between an acyl carrier protein and a ketosynthase.
17	PDB:7l4lA	0.149	0.852	7.330E-22	412	0.038	0.231	7l4lA.pdb.gz	Structure and Mechanistic Analyses of the Gating Mechanism of Elongating Ketosynthases
18	PDB:2c9hA	0.148	0.820	1.254E-20	427	0.040	0.237	2c9hA.pdb.gz
19	PDB:2ix4A	0.151	0.826	7.227E-20	431	0.037	0.218	2ix4A.pdb.gz	Structure of the Human Beta-Ketoacyl [Acp] Synthase from the Mitochondrial Type II Fatty Acid Synthase.
20	PDB:2gp6A	0.146	0.829	8.733E-20	415	0.039	0.234	2gp6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060XQE7	0.0	3268	2526	0.647	0.643	A0A060XQE7_ONCMY Fatty acid synthase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00062364001 PE=4 SV=1
2	A0A0U1RQF0	0.0	5143	2509	0.999	1.000	A0A0U1RQF0_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=1
3	A5YV76	0.0	4038	2512	0.787	0.787	A5YV76_PIG Fatty acid synthase OS=Sus scrofa OX=9823 GN=FASN PE=1 SV=1
4	B7Z001	0.0	1130	2540	0.220	0.218	B7Z001_DROME Fatty acid synthase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=FASN1 PE=1 SV=2
5	M9PB21	0.0	1053	2410	0.213	0.222	M9PB21_DROME Fatty acid synthase 2, isoform B OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=1 SV=1
6	P12276	0.0	3430	2512	0.661	0.661	FAS_CHICK Fatty acid synthase OS=Gallus gallus OX=9031 GN=FASN PE=1 SV=5
7	P12785	0.0	4192	2505	0.821	0.823	FAS_RAT Fatty acid synthase OS=Rattus norvegicus OX=10116 GN=Fasn PE=1 SV=3
8	P19096	0.0	4202	2504	0.813	0.815	FAS_MOUSE Fatty acid synthase OS=Mus musculus OX=10090 GN=Fasn PE=1 SV=2
9	P49327	0.0	5152	2511	1.000	1.000	FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3
10	Q7KML1	0.0	811	898	0.169	0.472	Q7KML1_DROME oleoyl-[acyl-carrier-protein] hydrolase OS=Drosophila melanogaster OX=7227 GN=FASN1 PE=2 SV=1
11	Q8MR70	0.0	952	1529	0.203	0.333	Q8MR70_DROME oleoyl-[acyl-carrier-protein] hydrolase (Fragment) OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=2 SV=1
12	Q9VQL6	0.0	1053	2409	0.213	0.222	Q9VQL6_DROME Fatty acid synthase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=FASN2 PE=1 SV=1
13	Q9VQL7	0.0	1132	2438	0.220	0.227	Q9VQL7_DROME Fatty acid synthase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=FASN1 PE=1 SV=1
14	Q869W9	6.42e-114	409	2603	0.138	0.133	PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum OX=44689 GN=pks16 PE=2 SV=1
15	Q869X2	3.73e-110	397	2604	0.137	0.132	PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum OX=44689 GN=pks17 PE=3 SV=1
16	P0DO30	1.95e-107	389	4036	0.126	0.078	ILIA_NEOS2 Hybrid PKS-NRPS synthetase iliA OS=Neonectria sp. (strain DH2) OX=1735992 GN=iliA PE=1 SV=1
17	Q55E72	1.04e-106	386	3147	0.119	0.095	PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum OX=44689 GN=stlA PE=1 SV=1
18	Q5BA83	1.98e-104	378	2534	0.121	0.120	EASB_EMENI Highly reducing polyketide synthase easB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=easB PE=3 SV=1
19	A0A482N9V7	2.24e-101	369	4015	0.128	0.080	ICCA_TALVA Hybrid PKS-NRPS synthetase iccA OS=Talaromyces variabilis OX=28576 GN=iccA PE=1 SV=1
20	Q9Y8A5	1.99e-98	359	3038	0.135	0.112	LOVB_ASPTE Lovastatin nonaketide synthase, polyketide synthase component OS=Aspergillus terreus OX=33178 GN=lovB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08545 ACP_syn_III	3.2e+02	12.6	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
2	PF00698 Acyl_transf_1	7.9e-113	388.8	Acyl transferase domain
3	PF00106 adh_short	0.03	25.3	short chain dehydrogenase
4	PF13561 adh_short_C2	89	14.1	Enoyl-(Acyl carrier protein) reductase
5	PF00107 ADH_zinc_N	5.1e-14	63.8	Zinc-binding dehydrogenase
6	PF13602 ADH_zinc_N_2	3.5e-12	58.9	Zinc-binding dehydrogenase
7	PF16197 KAsynt_C_assoc	4.2e-32	122.3	Ketoacyl-synthetase C-terminal extension
8	PF00109 ketoacyl-synt	6e-69	244.0	Beta-ketoacyl synthase, N-terminal domain
9	PF02801 Ketoacyl-synt_C	1.5e-34	129.9	Beta-ketoacyl synthase, C-terminal domain
10	PF08659 KR	5.8e-44	161.6	KR domain
11	PF08241 Methyltransf_11	0.67	22.0	Methyltransferase domain
12	PF08242 Methyltransf_12	0.00013	33.9	Methyltransferase domain
13	PF13489 Methyltransf_23	2.9	19.2	Methyltransferase domain
14	PF13649 Methyltransf_25	2.5	20.2	Methyltransferase domain
15	PF13847 Methyltransf_31	0.0073	27.6	Methyltransferase domain
16	PF08237 PE-PPE	4.7e+02	11.7	PE-PPE domain
17	PF00550 PP-binding	1.1e-06	40.2	Phosphopantetheine attachment site
18	PF14765 PS-DH	9.1e-15	66.3	Polyketide synthase dehydratase
19	PF00975 Thioesterase	1.5e-63	226.6	Thioesterase domain
20	PF00108 Thiolase_N	0.48	21.3	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304592

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483300	0.997	Acetyl-CoA carboxylase 1
2	9606.ENSP00000253792	0.996	ATP-citrate synthase
3	9606.ENSP00000348069	0.993	Sterol regulatory element-binding protein 1
4	9606.ENSP00000278618	0.990	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
5	9606.ENSP00000341044	0.988	Acetyl-CoA carboxylase 2
6	9606.ENSP00000422607	0.969	Long-chain-fatty-acid--CoA ligase 1
7	9606.ENSP00000477707	0.968	Oxysterols receptor LXR-alpha
8	9606.ENSP00000290429	0.960	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
9	9606.ENSP00000253727	0.956	Oxysterols receptor LXR-beta
10	9606.ENSP00000367462	0.955	S-acyl fatty acid synthase thioesterase, medium chain
11	9606.ENSP00000350012	0.954	Long-chain-fatty-acid--CoA ligase 3
12	9606.ENSP00000479130	0.951	Acyl-CoA synthetase family member 3, mitochondrial
13	9606.ENSP00000348429	0.949	Long-chain-fatty-acid--CoA ligase 5
14	9606.ENSP00000339787	0.948	Long-chain-fatty-acid--CoA ligase 4
15	9606.ENSP00000359380	0.938	Acyl-CoA desaturase
16	9606.ENSP00000280701	0.937	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
17	9606.ENSP00000368566	0.937	Long-chain-fatty-acid--CoA ligase 6
18	9606.ENSP00000465589	0.932	Long-chain-fatty-acid--CoA ligase ACSBG2
19	9606.ENSP00000419692	0.931	Retinoic acid receptor RXR-alpha
20	9606.ENSP00000258873	0.922	Long-chain-fatty-acid--CoA ligase ACSBG1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004312	1.000	fatty acid synthase activity
GO:0097159	0.997	organic cyclic compound binding
GO:1901363	0.996	heterocyclic compound binding
GO:0050839	0.996	cell adhesion molecule binding
GO:0003676	0.940	nucleic acid binding
GO:0042802	0.925	identical protein binding
GO:0045296	0.860	cadherin binding
GO:0003723	0.822	RNA binding
GO:0016417	0.753	S-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006082	0.985	organic acid metabolic process
GO:0032787	0.953	monocarboxylic acid metabolic process
GO:0006629	0.920	lipid metabolic process
GO:0006631	0.880	fatty acid metabolic process
GO:0009058	0.638	biosynthetic process
GO:1901576	0.560	organic substance biosynthetic process
GO:0065007	0.421	biological regulation
GO:0044249	0.403	cellular biosynthetic process
GO:0050896	0.366	response to stimulus
GO:0050789	0.361	regulation of biological process
GO:0008610	0.319	lipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0071944	0.992	cell periphery
GO:0012505	0.992	endomembrane system
GO:0070013	0.958	intracellular organelle lumen
GO:0005886	0.930	plasma membrane
GO:0005794	0.621	Golgi apparatus
GO:0005576	0.599	extracellular region
GO:0031982	0.560	vesicle
GO:0005739	0.413	mitochondrion
GO:0005615	0.362	extracellular space
GO:0043230	0.353	extracellular organelle
GO:0065010	0.330	extracellular membrane-bounded organelle
GO:1903561	0.323	extracellular vesicle
GO:0070062	0.310	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14993	1.000	acetyl-CoA + 2n H(+) + n malonyl-CoA + 2n NADPH = a long-chain fatty acid + n CO2 + (n+1) CoA + 2n NADP(+)
EC:2.3.1.85	1.000	fatty-acid synthase system.

[back to server]